KEGG   Homo sapiens (human): 2861
Entry
2861              CDS       T01001                                 

Gene name
GPR37, EDNRBL, PAELR, hET(B)R-LP
Definition
(RefSeq) G protein-coupled receptor 37
  KO
K04243  prosaposin receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa05012  Parkinson disease
Network
nt06420  Ubiquitin-proteasome system
nt06463  Parkinson disease
  Element
N01021  Parkin-mediated ubiquitination
N01022  Mutation-inactivated PRKN to Parkin-mediated ubiquitination
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    2861 (GPR37)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    2861 (GPR37)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Prosaposin
    2861 (GPR37)
SSDB
Motif
Pfam: 7tm_1 COX1
Other DBs
NCBI-GeneID: 2861
NCBI-ProteinID: NP_005293
OMIM: 602583
HGNC: 4494
Ensembl: ENSG00000170775
Vega: OTTHUMG00000157197
Pharos: O15354(Tbio)
UniProt: O15354
Position
7q31.33
AA seq 613 aa
MRAPGALLARMSRLLLLLLLKVSASSALGVAPASRNETCLGESCAPTVIQRRGRDAWGPG
NSARDVLRARAPREEQGAAFLAGPSWDLPAAPGRDPAAGRGAEASAAGPPGPPTRPPGPW
RWKGARGQEPSETLGRGNPTALQLFLQISEEEEKGPRGAGISGRSQEQSVKTVPGASDLF
YWPRRAGKLQGSHHKPLSKTANGLAGHEGWTIALPGRALAQNGSLGEGIHEPGGPRRGNS
TNRRVRLKNPFYPLTQESYGAYAVMCLSVVIFGTGIIGNLAVMCIVCHNYYMRSISNSLL
ANLAFWDFLIIFFCLPLVIFHELTKKWLLEDFSCKIVPYIEVASLGVTTFTLCALCIDRF
RAATNVQMYYEMIENCSSTTAKLAVIWVGALLLALPEVVLRQLSKEDLGFSGRAPAERCI
IKISPDLPDTIYVLALTYDSARLWWYFGCYFCLPTLFTITCSLVTARKIRKAEKACTRGN
KRQIQLESQMNCTVVALTILYGFCIIPENICNIVTAYMATGVSQQTMDLLNIISQFLLFF
KSCVTPVLLFCLCKPFSRAFMECCCCCCEECIQKSSTVTSDDNDNEYTTELELSPFSTIR
REMSTFASVGTHC
NT seq 1842 nt   +upstreamnt  +downstreamnt
atgcgagccccgggcgcgcttctcgcccgcatgtcgcggctactgcttctgctactgctc
aaggtgtctgcctcttctgccctcggggtcgcccctgcgtccagaaacgaaacttgtctg
ggggagagctgtgcacctacagtgatccagcgccgcggcagggacgcctggggaccggga
aattctgcaagagacgttctgcgagcccgagcacccagggaggagcagggggcagcgttt
cttgcgggaccctcctgggacctgccggcggccccgggccgtgacccggctgcaggcaga
ggggcggaggcgtcggcagccggacccccgggacctccaaccaggccacctggcccctgg
aggtggaaaggtgctcggggtcaggagccttctgaaactttggggagagggaaccccacg
gccctccagctcttccttcagatctcagaggaggaagagaagggtcccagaggcgctggc
atttccgggcgtagccaggagcagagtgtgaagacagtccccggagccagcgatcttttt
tactggccaaggagagccgggaaactccagggttcccaccacaagcccctgtccaagacg
gccaatggactggcggggcacgaagggtggacaattgcactcccgggccgggcgctggcc
cagaatggatccttgggtgaaggaatccatgagcctgggggtccccgccggggaaacagc
acgaaccggcgtgtgagactgaagaaccccttctacccgctgacccaggagtcctatgga
gcctacgcggtcatgtgtctgtccgtggtgatcttcgggaccggcatcattggcaacctg
gcggtgatgtgcatcgtgtgccacaactactacatgcggagcatctccaactccctcttg
gccaacctggccttctgggactttctcatcatcttcttctgccttccgctggtcatcttc
cacgagctgaccaagaagtggctgctggaggacttctcctgcaagatcgtgccctatata
gaggtcgcttctctgggagtcaccactttcaccttatgtgctctgtgcatagaccgcttc
cgtgctgccaccaacgtacagatgtactacgaaatgatcgaaaactgttcctcaacaact
gccaaacttgctgttatatgggtgggagctctattgttagcacttccagaagttgttctc
cgccagctgagcaaggaggatttggggtttagtggccgagctccggcagaaaggtgcatt
attaagatctctcctgatttaccagacaccatctatgttctagccctcacctacgacagt
gcgagactgtggtggtattttggctgttacttttgtttgcccacgcttttcaccatcacc
tgctctctagtgactgcgaggaaaatccgcaaagcagagaaagcctgtacccgagggaat
aaacggcagattcaactagagagtcagatgaactgtacagtagtggcactgaccatttta
tatggattttgcattattcctgaaaatatctgcaacattgttactgcctacatggctaca
ggggtttcacagcagacaatggacctccttaatatcatcagccagttccttttgttcttt
aagtcctgtgtcaccccagtcctccttttctgtctctgcaaacccttcagtcgggccttc
atggagtgctgctgctgttgctgtgaggaatgcattcagaagtcttcaacggtgaccagt
gatgacaatgacaacgagtacaccacggaactcgaactctcgcctttcagtaccatacgc
cgtgaaatgtccacttttgcttctgtcggaactcattgctga

DBGET integrated database retrieval system