KEGG   Homo sapiens (human): 286133
Entry
286133            CDS       T01001                                 

Gene name
SCARA5, NET33, Tesr
Definition
(RefSeq) scavenger receptor class A member 5
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: SRCR Collagen SRCR_2 Hepsin-SRCR OppC_N
Other DBs
NCBI-GeneID: 286133
NCBI-ProteinID: NP_776194
OMIM: 611306
HGNC: 28701
Ensembl: ENSG00000168079
Vega: OTTHUMG00000132172
Pharos: Q6ZMJ2(Tbio)
UniProt: Q6ZMJ2
Position
8p21.1
AA seq 495 aa
MENKAMYLHTVSDCDTSSICEDSFDGRSLSKLNLCEDGPCHKRRASICCTQLGSLSALKH
AVLGLYLLVFLILVGIFILAVSRPRSSPDDLKALTRNVNRLNESFRDLQLRLLQAPLQAD
LTEQVWKVQDALQNQSDSLLALAGAVQRLEGALWGLQAQAVQTEQAVALLRDRTGQQSDT
AQLELYQLQVESNSSQLLLRRHAGLLDGLARRVGILGEELADVGGVLRGLNHSLSYDVAL
HRTRLQDLRVLVSNASEDTRRLRLAHVGMELQLKQELAMLNAVTEDLRLKDWEHSIALRN
ISLAKGPPGPKGDQGDEGKEGRPGIPGLPGLRGLPGERGTPGLPGPKGDDGKLGATGPMG
MRGFKGDRGPKGEKGEKGDRAGDASGVEAPMMIRLVNGSGPHEGRVEVYHDRRWGTVCDD
GWDKKDGDVVCRMLGFRGVEEVYRTARFGQGTGRIWMDDVACKGTEETIFRCSFSKWGVT
NCGHAEDASVTCNRH
NT seq 1488 nt   +upstreamnt  +downstreamnt
atggagaacaaagctatgtacctacacaccgtcagcgactgtgacaccagctccatctgt
gaggattcctttgatggcaggagcctgtccaagctgaacctgtgtgaggatggtccatgt
cacaaacggcgggcaagcatctgctgtacccagctggggtccctgtcggccctgaagcat
gctgtcctggggctctacctgctggtcttcctgattcttgtgggcatcttcatcttagca
gtgtccaggccgcgcagctcccctgacgacctgaaggccctgactcgcaatgtgaaccgg
ctgaatgagagcttccgggacttgcagctgcggctgctgcaggctccgctgcaagcggac
ctgacggagcaggtgtggaaggtgcaggacgcgctgcagaaccagtcagactcgttgctg
gcgctggcgggcgcagtgcagcggctggagggcgcgctgtgggggctgcaggcgcaggcg
gtgcagaccgagcaggcggtggccctgctgcgggaccgcacgggccagcagagcgacacg
gcgcagctggagctctaccagctgcaggtggagagcaacagtagccagctgctgctgagg
cgccacgcgggcctgctggacgggctggcgcgcagggtgggcatcctgggcgaggagctg
gccgacgtgggcggcgtgctgcgcggcctcaaccacagcctgtcctacgacgtggccctc
caccgcacgcggctgcaggacctgcgggtgctggtgagcaacgccagcgaggacacgcgc
cgcctgcgcctggcgcacgtaggcatggagctgcagctgaagcaggagctggccatgctc
aacgcggtcaccgaggacctgcgcctcaaggactgggagcactccatcgcactgcggaac
atctccctcgcgaaagggccaccgggacccaaaggtgatcagggggatgaaggaaaggaa
ggcaggcctggcatccctggattgcctggacttcgaggtctgcccggggagagaggtacc
ccaggattgcccgggcccaagggcgatgatgggaagctgggggccacaggaccaatgggc
atgcgtgggttcaaaggtgaccgaggcccaaaaggagagaaaggagagaaaggagacaga
gctggggatgccagtggcgtggaggccccgatgatgatccgcctggtgaatggctcaggt
ccgcacgagggccgcgtggaagtgtaccacgaccggcgttggggcaccgtgtgtgacgac
ggctgggacaagaaggacggagacgtggtgtgccgcatgctcggcttccgcggtgtggag
gaggtgtaccgcacagctcgattcgggcaaggcactgggaggatctggatggatgacgtt
gcctgcaagggcacagaggaaaccatcttccgctgcagcttctccaaatggggggtgaca
aactgtggacatgccgaagatgccagcgtgacatgcaacagacactga

DBGET integrated database retrieval system