KEGG   Homo sapiens (human): 286257
Entry
286257            CDS       T01001                                 
Symbol
PAXX, C9orf142, XLS
Name
(RefSeq) PAXX non-homologous end joining factor
  KO
K25772  protein PAXX
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    286257 (PAXX)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Other NHEJ factors
     286257 (PAXX)
SSDB
Motif
Pfam: PAXX
Other DBs
NCBI-GeneID: 286257
NCBI-ProteinID: NP_899064
OMIM: 616315
HGNC: 27849
Ensembl: ENSG00000148362
Pharos: Q9BUH6(Tbio)
UniProt: Q9BUH6
Structure
Position
9:136992422..136993976
AA seq 204 aa
MDPLSPPLCTLPPGPEPPRFVCYCEGEESGEGDRGGFNLYVTDAAELWSTCFTPDSLAAL
KARFGLSAAEDITPRFRAACEQQAVALTLQEDRASLTLSGGPSALAFDLSKVPGPEAAPR
LRALTLGLAKRVWSLERRLAAAEETAVSPRKSPRPAGPQLFLPDPDPQRGGPGPGVRRRC
PGESLINPGFKSKKPAGGVDFDET
NT seq 615 nt   +upstreamnt  +downstreamnt
atggatccgctgtcgccgccgctctgcacgctgccgccgggccccgagccgccccgcttc
gtgtgctactgcgaaggggaggaaagcggggagggggaccgcggcggcttcaacctctac
gtgaccgacgccgcggagctttggagcacctgcttcacgccggacagcctggcggccctc
aaagcccgttttggcctgagtgcggctgaggacatcaccccccggttcagggcagcctgt
gagcagcaagctgtggctctgactctgcaggaggacagagcatccctgacgctttcaggg
gggccctcggcactggcctttgacctctccaaggtaccaggcccagaggcagcccccagg
ctgcgggcgctgacactgggcctggcaaaacgcgtgtggagcctggagcggcgactggca
gctgcagaagagacagctgtcagcccgaggaagagcccccggcctgcagggcctcagctc
ttcttaccagacccagatccccagagaggtggccctggacctggagtcaggaggcggtgt
ccaggagagtcgctcatcaaccccgggttcaagagtaagaaaccagctggtggcgtggac
ttcgatgagacctga

DBGET integrated database retrieval system