KEGG   Homo sapiens (human): 286257
Entry
286257            CDS       T01001                                 

Gene name
PAXX, C9orf142, XLS
Definition
(RefSeq) PAXX non-homologous end joining factor
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: PAXX
Other DBs
NCBI-GeneID: 286257
NCBI-ProteinID: NP_899064
OMIM: 616315
HGNC: 27849
Ensembl: ENSG00000148362
Vega: OTTHUMG00000020971
Pharos: Q9BUH6(Tbio)
UniProt: Q9BUH6
Structure
PDB: 
3WTD 4WJA 3WTF

Position
9q34.3
AA seq 204 aa
MDPLSPPLCTLPPGPEPPRFVCYCEGEESGEGDRGGFNLYVTDAAELWSTCFTPDSLAAL
KARFGLSAAEDITPRFRAACEQQAVALTLQEDRASLTLSGGPSALAFDLSKVPGPEAAPR
LRALTLGLAKRVWSLERRLAAAEETAVSPRKSPRPAGPQLFLPDPDPQRGGPGPGVRRRC
PGESLINPGFKSKKPAGGVDFDET
NT seq 615 nt   +upstreamnt  +downstreamnt
atggatccgctgtcgccgccgctctgcacgctgccgccgggccccgagccgccccgcttc
gtgtgctactgcgaaggggaggaaagcggggagggggaccgcggcggcttcaacctctac
gtgaccgacgccgcggagctttggagcacctgcttcacgccggacagcctggcggccctc
aaagcccgttttggcctgagtgcggctgaggacatcaccccccggttcagggcagcctgt
gagcagcaagctgtggctctgactctgcaggaggacagagcatccctgacgctttcaggg
gggccctcggcactggcctttgacctctccaaggtaccaggcccagaggcagcccccagg
ctgcgggcgctgacactgggcctggcaaaacgcgtgtggagcctggagcggcgactggca
gctgcagaagagacagctgtcagcccgaggaagagcccccggcctgcagggcctcagctc
ttcttaccagacccagatccccagagaggtggccctggacctggagtcaggaggcggtgt
ccaggagagtcgctcatcaaccccgggttcaagagtaagaaaccagctggtggcgtggac
ttcgatgagacctga

DBGET integrated database retrieval system