KEGG   Homo sapiens (human): 286365Help
Entry
286365            CDS       T01001                                 

Gene name
OR13D1, OR9-15
Definition
(RefSeq) olfactory receptor family 13 subfamily D member 1
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    286365 (OR13D1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    286365 (OR13D1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 286365
NCBI-ProteinID: NP_001004484
HGNC: 14695
Ensembl: ENSG00000179055
Vega: OTTHUMG00000020412
Pharos: Q8NGV5(Tdark)
UniProt: Q8NGV5
Position
9q31.1
AA seq 346 aa AA seqDB search
MYRFTDFDVSNISIYLNHVLFYTTQQAGDLEHMETRNYSAMTEFFLVGLSQYPELQLFLF
LLCLIMYMIILLGNSLLIIITILDSRLHTPMYFFLGNLSFLDICYTSSSIPPMLIIFMSE
RKSISFIGCALQMVVSLGLGSTECVLLAVMAYDHYVAICNPLRYSIIMNGVLYVQMAAWS
WIIGCLTSLLQTVLTMMLPFCGNNVIDHITCEILALLKLVCSDITINVLIMTVTNIVSLV
ILLLLIFISYVFILSSILRINCAEGRKKAFSTCSAHSIVVILFYGSALFMYMKPKSKNTN
TSDEIIGLSYGVVSPMLNPIIYSLRNKEVKEAVKKVLSRHLHLLKM
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgtacagatttacagattttgatgtatcaaacatttcaatttacctgaatcatgtcctt
ttctatactacccagcaggcaggtgacctagaacacatggagacaagaaattactctgcc
atgactgaattctttctggtggggctttcccaatatccagagctccagctttttctgttc
ctgctctgcctcatcatgtacatgataatcctcctgggaaatagcctcctcattatcatc
accatcttggattctcgcctccatactcccatgtatttctttcttggaaacctctcattc
ttggacatctgttacacatcctcatccattcctccaatgcttattatatttatgtctgag
agaaaatccatctccttcattggctgtgctctgcagatggttgtgtcccttggcttgggc
tccactgagtgtgtcctcctggctgtgatggcctatgaccactatgtggccatctgcaac
ccactgaggtactccatcatcatgaacggagtgctgtatgtgcaaatggctgcatggtcc
tggatcataggctgtctgacctccctattgcaaacagttctgacaatgatgttgcctttc
tgtgggaataatgtcattgatcatattacctgtgaaattttggcccttctaaaacttgtt
tgttcagatatcaccatcaatgtgcttatcatgacagtgacaaatattgtttcactggtg
attcttctactgttaattttcatctcctatgtgtttattctctcttccatcctgagaatt
aattgtgctgagggaagaaagaaagccttctctacctgttcagcgcactcgattgtggtc
atcttattctacggttcagccctttttatgtacatgaaacccaagtcaaagaacactaat
acatctgatgagattattgggctgtcttatggagtggtaagcccaatgttaaatcccatc
atctatagcctcaggaataaagaggtcaaagaggctgtaaagaaagtcctgagcagacat
ctgcatttattgaaaatgtga

DBGET integrated database retrieval system