KEGG   Homo sapiens (human): 2864Help
Entry
2864              CDS       T01001                                 

Gene name
FFAR1, FFA1R, GPCR40, GPR40
Definition
(RefSeq) free fatty acid receptor 1
  KO
K04325  free fatty acid receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04911  Insulin secretion
Drug target
Fasiglifam (DG01681): D10336 D10567
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    2864 (FFAR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    2864 (FFAR1)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Lipid
   Free fatty acid
    2864 (FFAR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 2864
NCBI-ProteinID: NP_005294
OMIM: 603820
HGNC: 4498
Ensembl: ENSG00000126266
Vega: OTTHUMG00000188261
Pharos: O14842(Tchem)
UniProt: O14842
Position
19q13.12
AA seq 300 aa AA seqDB search
MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLP
LKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRP
CYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAG
PARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPY
NASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggacctgcccccgcagctctccttcggcctctatgtggccgcctttgcgctgggcttc
ccgctcaacgtcctggccatccgaggcgcgacggcccacgcccggctccgtctcacccct
agcctggtctacgccctgaacctgggctgctccgacctgctgctgacagtctctctgccc
ctgaaggcggtggaggcgctagcctccggggcctggcctctgccggcctcgctgtgcccc
gtcttcgcggtggcccacttcttcccactctatgccggcgggggcttcctggccgccctg
agtgcaggccgctacctgggagcagccttccccttgggctaccaagccttccggaggccg
tgctattcctggggggtgtgcgcggccatctgggccctcgtcctgtgtcacctgggtctg
gtctttgggttggaggctccaggaggctggctggaccacagcaacacctccctgggcatc
aacacaccggtcaacggctctccggtctgcctggaggcctgggacccggcctctgccggc
ccggcccgcttcagcctctctctcctgctcttttttctgcccttggccatcacagccttc
tgctacgtgggctgcctccgggcactggcccgctccggcctgacgcacaggcggaagctg
cgggccgcctgggtggccggcggggccctcctcacgctgctgctctgcgtaggaccctac
aacgcctccaacgtggccagcttcctgtaccccaatctaggaggctcctggcggaagctg
gggctcatcacgggtgcctggagtgtggtgcttaatccgctggtgaccggttacttggga
aggggtcctggcctgaagacagtgtgtgcggcaagaacgcaagggggcaagtcccagaag
taa

DBGET integrated database retrieval system