KEGG   Homo sapiens (human): 286436Help
Entry
286436            CDS       T01001                                 

Gene name
H2BW2, H2BFM, H2BM
Definition
(RefSeq) H2B.W histone 2
  KO
K11252  histone H2B
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    286436 (H2BW2)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    286436 (H2BW2)
  09165 Substance dependence
   05034 Alcoholism
    286436 (H2BW2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    286436 (H2BW2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    286436 (H2BW2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    286436 (H2BW2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   286436 (H2BW2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TAF TFIID_20kDa CENP-S TFIID-18kDa
Motif
Other DBs
NCBI-GeneID: 286436
NCBI-ProteinID: NP_001157888
HGNC: 27867
Ensembl: ENSG00000101812
Vega: OTTHUMG00000022122
Pharos: P0C1H6(Tdark)
UniProt: P0C1H6 W0TYI6
Position
Xq22.2
AA seq 154 aa AA seqDB search
MAAASAMAEASSETTSEEGQSIQEPKEANSTKAQKQKRRGCRGSRRRHANRRGDSFGDSF
TPYFPRVLKQVHQGLSLSQEAVSVMDSMIHDILDRIATEAGQLAHYTKRVTITSRDIQMA
VRLLLPGKMGKLAEAQGTNAALRTSLCAIWQQRK
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggccgctgcttccgccatggctgaggcttcctctgagacaacctcggaggaaggccag
agcatccaggagcccaaagaggccaactccacgaaggcccagaagcagaagaggcgaggg
tgccgaggctcccgcaggcgccacgccaaccgccgtggggacagcttcggggacagcttc
accccctatttcccccgggtgctgaagcaggttcaccagggcctcagcctttcccaggag
gccgtgagtgtcatggattctatgatccatgacatattggaccgcatcgccaccgaggct
ggtcagctggcccattacaccaagcgcgtgaccatcacctcccgggacatccagatggcc
gtgcgactgctgctgccggggaagatgggcaagctcgccgaggcccagggcacgaatgcc
gccctcagaacttcattatgtgcgatatggcaacagagaaagtga

DBGET integrated database retrieval system