KEGG   Homo sapiens (human): 286530
Entry
286530            CDS       T01001                                 
Symbol
P2RY8, P2Y8
Name
(RefSeq) P2Y receptor family member 8
  KO
K08386  P2Y purinoceptor 8
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    286530 (P2RY8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    286530 (P2RY8)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Base and nucleoside
   Purine / pyrimidine
    286530 (P2RY8)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx UPF0542
Other DBs
NCBI-GeneID: 286530
NCBI-ProteinID: NP_835230
OMIM: 300525
HGNC: 15524
Ensembl: ENSG00000182162
Vega: OTTHUMG00000021060
Pharos: Q86VZ1(Tbio)
UniProt: Q86VZ1
Position
X:complement(1462581..1537185), Y:complement(1462581..1537185)
AA seq 359 aa
MQVPNSTGPDNATLQMLRNPAIAVALPVVYSLVAAVSIPGNLFSLWVLCRRMGPRSPSVI
FMINLSVTDLMLASVLPFQIYYHCNRHHWVFGVLLCNVVTVAFYANMYSSILTMTCISVE
RFLGVLYPLSSKRWRRRRYAVAACAGTWLLLLTALSPLARTDLTYPVHALGIITCFDVLK
WTMLPSVAMWAVFLFTIFILLFLIPFVITVACYTATILKLLRTEEAHGREQRRRAVGLAA
VVLLAFVTCFAPNNFVLLAHIVSRLFYGKSYYHVYKLTLCLSCLNNCLDPFVYYFASREF
QLRLREYLGCRRVPRDTLDTRRESLFSARTTSVRSEAGAHPEGMEGATRPGLQRQESVF
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgcaggtcccgaacagcaccggcccggacaacgcgacgctgcagatgctgcggaacccg
gcgatcgcggtggccctgcccgtggtgtactcgctggtggcggcggtcagcatcccgggc
aacctcttctctctgtgggtgctgtgccggcgcatggggcccagatccccgtcggtcatc
ttcatgatcaacctgagcgtcacggacctgatgctggccagcgtgttgcctttccaaatc
tactaccattgcaaccgccaccactgggtattcggggtgctgctttgcaacgtggtgacc
gtggccttttacgcaaacatgtattccagcatcctcaccatgacctgtatcagcgtggag
cgcttcctgggggtcctgtacccgctcagctccaagcgctggcgccgccgtcgttacgcg
gtggccgcgtgtgcagggacctggctgctgctcctgaccgccctgtccccgctggcgcgc
accgatctcacctacccggtgcacgccctgggcatcatcacctgcttcgacgtcctcaag
tggacgatgctccccagcgtggccatgtgggccgtgttcctcttcaccatcttcatcctg
ctgttcctcatcccgttcgtgatcaccgtggcttgttacacggccaccatcctcaagctg
ttgcgcacggaggaggcgcacggccgggagcagcggaggcgcgcggtgggcctggccgcg
gtggtcttgctggcctttgtcacctgcttcgcccccaacaacttcgtgctcctggcgcac
atcgtgagccgcctgttctacggcaagagctactaccacgtgtacaagctcacgctgtgt
ctcagctgcctcaacaactgtctggacccgtttgtttattactttgcgtcccgggaattc
cagctgcgcctgcgggaatatttgggctgccgccgggtgcccagagacaccctggacacg
cgccgcgagagcctcttctccgccaggaccacgtccgtgcgctccgaggccggtgcgcac
cctgaagggatggagggagccaccaggcccggcctccagaggcaggagagtgtgttctga

DBGET integrated database retrieval system