KEGG   Homo sapiens (human): 286676Help
Entry
286676            CDS       T01001                                 

Gene name
ILDR1, DFNB42, ILDR1alpha, ILDR1alpha', ILDR1beta
Definition
(RefSeq) immunoglobulin like domain containing receptor 1
Organism
hsa  Homo sapiens (human)
Disease
H00605  Deafness, autosomal recessive
SSDB OrthologParalogGFIT
Motif
Pfam: LSR V-set
Motif
Other DBs
NCBI-GeneID: 286676
NCBI-ProteinID: NP_001186728
OMIM: 609739
HGNC: 28741
Ensembl: ENSG00000145103
Vega: OTTHUMG00000159481
Pharos: Q86SU0(Tbio)
UniProt: Q86SU0
Position
3q13.33
AA seq 546 aa AA seqDB search
MAWPKLPAPWLLLCTWLPAGCLSLLVTVQHTERYVTLFASIILKCDYTTSAQLQDVVVTW
RFKSFCKDPIFDYYSASYQAALSLGQDPSNDCNDNQREVRIVAQRRGQNEPVLGVDYRQR
KITIQNRADLVINEVMWWDHGVYYCTIEAPGDTSGDPDKEVKLIVLHWLTVIFIILGALL
LLLLIGVCWCQCCPQYCCCYIRCPCCPAHCCCPEEALARHRYMKQAQALGPQMMGKPLYW
GADRSSQVSSYPMHPLLQRDLSLPSSLPQMPMTQTTNQPPIANGVLEYLEKELRNLNLAQ
PLPPDLKGRFGHPCSMLSSLGSEVVERRIIHLPPLIRDLSSSRRTSDSLHQQWLTPIPSR
PWDLREGRSHHHYPDFHQELQDRGPKSWALERRELDPSWSGRHRSSRLNGSPIHWSDRDS
LSDVPSSSEARWRPSHPPFRSRCQERPRRPSPRESTQRHGRRRRHRSYSPPLPSGLSSWS
SEEDKERQPQSWRAHRRGSHSPHWPEEKPPSYRSLDITPGKNSRKKGSVERRSEKDSSHS
GRSVVI
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atggcatggcccaaactgcccgcaccttggctgctgctctgcacctggctcccagcaggg
tgcctgtccttgcttgtgacggtccagcacacagaacgctatgtcaccctgtttgcctct
atcatcctcaaatgtgactacaccacctctgcccagctccaggacgtggtggtgacatgg
cgcttcaagtccttctgcaaggaccctatctttgactactactcagcgtcataccaggca
gctttatccctgggccaggacccatccaatgactgcaacgacaaccagcgggaagttcgc
atagtggcccagcggcgggggcagaatgagcccgtgctgggggtagattaccggcagcgc
aagatcaccatccagaaccgagcagatctcgtgataaatgaagtgatgtggtgggaccat
ggagtgtattactgcaccattgaggctccaggggacacatcaggagaccccgataaggaa
gtaaagctcatcgtcctacactggctgacagtgatcttcatcatcctgggagccctcctc
ctcctgctgctgattggagtgtgctggtgccagtgctgtcctcagtattgctgctgctat
atccgctgtccctgctgtcctgcccactgctgctgtcctgaggaagccctggcccgccac
cgctacatgaagcaggcccaggccctaggtcctcagatgatgggaaaacccctgtactgg
ggggcggacaggagctcccaggtttcatcttatccaatgcacccgctgctgcagcgagat
ttgtccctgccgtccagcctcccgcagatgccaatgacccagaccaccaatcagcctccc
atcgccaatggtgtcctggagtatttggagaaagaactgcggaacctcaacctggcccag
cctctgccccctgacctcaaaggcagatttggccatccctgcagcatgctgtcctccctg
ggctctgaggtcgtggaacgcagaatcatccacctgcccccactgatcagagacctgtca
tcctcaaggaggaccagtgactccctgcaccagcagtggctcaccccaattccctccagg
ccctgggatctgagggaggggagaagccaccaccattaccctgatttccaccaggagctc
caggaccgggggccaaagtcttgggcattggaaagaagggagttggacccatcgtggagt
ggaaggcaccgtagctctaggctgaatgggtcacccatacactggtcagacagggacagc
ctaagcgatgtcccctcatccagtgaggcacgctggcggccgagccaccctcctttcagg
agccgctgtcaggagaggccccgcaggcccagcccccgggagagcactcagaggcacggg
agacgacgcaggcaccgcagctactctcctcccttgccctccggcctcagttcctggagc
tctgaagaggacaaggagaggcagccccagagctggcgggcccaccgccgcggctcgcac
tccccacactggcccgaggagaagccgcctagctaccgctcacttgatatcactccaggc
aagaatagcaggaaaaaagggagtgtggagaggcgctcggagaaagacagctctcatagt
ggaaggagtgtggtcatttag

DBGET integrated database retrieval system