KEGG   Homo sapiens (human): 2867Help
Entry
2867              CDS       T01001                                 

Gene name
FFAR2, FFA2R, GPR43
Definition
(RefSeq) free fatty acid receptor 2
  KO
K04328  free fatty acid receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    2867 (FFAR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    2867 (FFAR2)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Lipid
   Free fatty acid
    2867 (FFAR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srv TAS2R 7TM_GPCR_Srx 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 2867
NCBI-ProteinID: NP_005297
OMIM: 603823
HGNC: 4501
Ensembl: ENSG00000126262
Vega: OTTHUMG00000183303
Pharos: O15552(Tchem)
UniProt: O15552 C6KYL4
Position
19q13.12
AA seq 330 aa AA seqDB search
MLPDWKSSLILMAYIIIFLTGLPANLLALRAFVGRIRQPQPAPVHILLLSLTLADLLLLL
LLPFKIIEAASNFRWYLPKVVCALTSFGFYSSIYCSTWLLAGISIERYLGVAFPVQYKLS
RRPLYGVIAALVAWVMSFGHCTIVIIVQYLNTTEQVRSGNEITCYENFTDNQLDVVLPVR
LELCLVLFFIPMAVTIFCYWRFVWIMLSQPLVGAQRRRRAVGLAVVTLLNFLVCFGPYNV
SHLVGYHQRKSPWWRSIAVVFSSLNASLDPLLFYFSSSVVRRAFGRGLQVLRNQGSSLLG
RRGKDTAEGTNEDRGVGQGEGMPSSDFTTE
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgctgccggactggaagagctccttgatcctcatggcttacatcatcatcttcctcact
ggcctccctgccaacctcctggccctgcgggcctttgtggggcggatccgccagccccag
cctgcacctgtgcacatcctcctgctgagcctgacgctggccgacctcctcctgctgctg
ctgctgcccttcaagatcatcgaggctgcgtcgaacttccgctggtacctgcccaaggtc
gtctgcgccctcacgagttttggcttctacagcagcatctactgcagcacgtggctcctg
gcgggcatcagcatcgagcgctacctgggagtggctttccccgtgcagtacaagctctcc
cgccggcctctgtatggagtgattgcagctctggtggcctgggttatgtcctttggtcac
tgcaccatcgtgatcatcgttcaatacttgaacacgactgagcaggtcagaagtggcaat
gaaattacctgctacgagaacttcaccgataaccagttggacgtggtgctgcccgtgcgg
ctggagctgtgcctggtgctcttcttcatccccatggcagtcaccatcttctgctactgg
cgttttgtgtggatcatgctctcccagccccttgtgggggcccagaggcggcgccgagcc
gtggggctggctgtggtgacgctgctcaatttcctggtgtgcttcggaccttacaacgtg
tcccacctggtggggtatcaccagagaaaaagcccctggtggcggtcaatagccgtggtg
ttcagttcactcaacgccagtctggaccccctgctcttctatttctcttcttcagtggtg
cgcagggcatttgggagagggctgcaggtgctgcggaatcagggctcctccctgttggga
cgcagaggcaaagacacagcagaggggacaaatgaggacaggggtgtgggtcaaggagaa
gggatgccaagttcggacttcactacagagtag

DBGET integrated database retrieval system