KEGG   Homo sapiens (human): 286887
Entry
286887            CDS       T01001                                 

Gene name
KRT6C, K6E, KRT6E, PPKNEFD
Definition
(RefSeq) keratin 6C
  KO
K07605  type II keratin, basic
Organism
hsa  Homo sapiens (human)
Disease
H00723  Non-epidermolytic palmoplantar keratoderma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    286887 (KRT6C)
   04147 Exosome [BR:hsa04147]
    286887 (KRT6C)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     286887 (KRT6C)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   286887 (KRT6C)
  Exosomal proteins of other body fluids (saliva and urine)
   286887 (KRT6C)
  Exosomal proteins of colorectal cancer cells
   286887 (KRT6C)
  Exosomal proteins of bladder cancer cells
   286887 (KRT6C)
SSDB
Motif
Pfam: Filament Keratin_2_head TPR_MLP1_2 CENP-F_leu_zip Spc7 ATG16 Tropomyosin_1 UPF0184 DUF745 Alanine_zipper APG6_N Baculo_PEP_C V_ATPase_I Jnk-SapK_ap_N Ax_dynein_light Golgin_A5 FapA ADIP
Other DBs
NCBI-GeneID: 286887
NCBI-ProteinID: NP_775109
OMIM: 612315
HGNC: 20406
Ensembl: ENSG00000170465
Vega: OTTHUMG00000169596
Pharos: P48668(Tdark)
UniProt: P48668
Position
12q13.13
AA seq 564 aa
MASTSTTIRSHSSSRRGFSANSARLPGVSRSGFSSISVSRSRGSGGLGGACGGAGFGSRS
LYGLGGSKRISIGGGSCAISGGYGSRAGGSYGFGGAGSGFGFGGGAGIGFGLGGGAGLAG
GFGGPGFPVCPPGGIQEVTVNQSLLTPLNLQIDPAIQRVRAEEREQIKTLNNKFASFIDK
VRFLEQQNKVLDTKWTLLQEQGTKTVRQNLEPLFEQYINNLRRQLDSIVGERGRLDSELR
NMQDLVEDLKNKYEDEINKRTAAENEFVTLKKDVDAAYMNKVELQAKADTLTDEINFLRA
LYDAELSQMQTHISDTSVVLSMDNNRNLDLDSIIAEVKAQYEEIAQRSRAEAESWYQTKY
EELQVTAGRHGDDLRNTKQEIAEINRMIQRLRSEIDHVKKQCASLQAAIADAEQRGEMAL
KDAKNKLEGLEDALQKAKQDLARLLKEYQELMNVKLALDVEIATYRKLLEGEECRLNGEG
VGQVNVSVVQSTISSGYGGASGVGSGLGLGGGSSYSYGSGLGIGGGFSSSSGRAIGGGLS
SVGGGSSTIKYTTTSSSSRKSYKH
NT seq 1695 nt   +upstreamnt  +downstreamnt
atggccagcacatccaccaccatcaggagccacagcagcagccgccggggtttcagtgcc
aactcagccaggctccctggggtcagccgctctggcttcagcagcatctccgtgtcccgc
tccaggggcagtggtggcctgggtggtgcatgtggaggagctggctttggcagccgcagt
ctgtatggcctggggggctccaagaggatctccattggagggggcagctgtgccatcagt
ggcggctatggcagcagagccggaggcagctatggctttggtggcgccgggagtggattt
ggtttcggtggtggagccggcattggctttggtctgggtggtggagccggccttgctggt
ggctttgggggccctggcttccctgtgtgcccccctggaggcatccaagaggtcaccgtc
aaccagagtctcctgactcccctcaacctgcaaattgaccccgccatccagcgggtgcgg
gccgaggagcgtgagcagatcaagaccctcaacaacaagtttgcctccttcatcgacaag
gtgcggttcctagagcagcagaacaaggttctggacaccaagtggaccctgctgcaggag
cagggcaccaagactgtgaggcagaacctggagccgttgttcgagcagtacatcaacaac
ctcaggaggcagctggacagcatcgtcggggaacggggccgcctggactcggagctgaga
aacatgcaggacctggtggaggacctcaagaacaaatatgaggatgaaatcaacaagcgc
acagcagcagagaatgaatttgtgactctgaagaaggatgtggatgctgcctacatgaac
aaggttgaactgcaagccaaggcagacactctcacagatgagatcaacttcctgagagcc
ttgtatgatgcagagctgtcccagatgcagacccacatctcagacacatccgtggtgcta
tccatggacaacaaccgcaacctggacctggacagcatcatcgctgaggtcaaggcccaa
tacgaggagattgctcagaggagccgggctgaggctgagtcctggtaccagaccaagtac
gaggagctgcaggtcacagcaggcagacatggggacgacctgcgcaacaccaagcaggag
attgctgagatcaaccgcatgatccagaggctgagatctgagatcgaccatgtcaagaag
cagtgtgccagcctgcaggctgccattgctgatgctgagcagcgtggggagatggcactc
aaggatgctaagaacaagctggaagggctggaggatgccctgcagaaggccaagcaggac
ctggcccggctgctgaaggagtaccaggagctgatgaatgtcaagctggccctggatgtg
gagatcgccacctaccgcaagctgctggagggcgaggagtgcaggctgaatggcgaaggc
gttggacaagtcaacgtctctgtagtacagtccaccatctccagtggctatggcggtgcc
agcggtgtcggcagtggcttaggcctgggtggaggaagcagctactcctatggcagtggt
cttggcattggaggtggcttcagttccagcagtggcagagccattgggggtggcctcagc
tctgttggaggcggcagttccaccatcaagtacaccaccacctcctcctccagcaggaag
agctacaagcactaa

DBGET integrated database retrieval system