KEGG   Homo sapiens (human): 2869Help
Entry
2869              CDS       T01001                                 

Gene name
GRK5, GPRK5
Definition
(RefSeq) G protein-coupled receptor kinase 5
  KO
K08291  G protein-coupled receptor kinase [EC:2.7.11.16]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04062  Chemokine signaling pathway
hsa04144  Endocytosis
hsa05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    2869 (GRK5)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    2869 (GRK5)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    2869 (GRK5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    2869 (GRK5)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.16  G-protein-coupled receptor kinase
     2869 (GRK5)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   2869 (GRK5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr RGS Kinase-like Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 2869
NCBI-ProteinID: NP_005299
OMIM: 600870
HGNC: 4544
Ensembl: ENSG00000198873
Vega: OTTHUMG00000019149
Pharos: P34947(Tbio)
UniProt: P34947
Structure
PDB: 

Position
10q26.11
AA seq 590 aa AA seqDB search
MELENIVANTVLLKAREGGGGKRKGKSKKWKEILKFPHISQCEDLRRTIDRDYCSLCDKQ
PIGRLLFRQFCETRPGLECYIQFLDSVAEYEVTPDEKLGEKGKEIMTKYLTPKSPVFIAQ
VGQDLVSQTEEKLLQKPCKELFSACAQSVHEYLRGEPFHEYLDSMFFDRFLQWKWLERQP
VTKNTFRQYRVLGKGGFGEVCACQVRATGKMYACKRLEKKRIKKRKGESMALNEKQILEK
VNSQFVVNLAYAYETKDALCLVLTIMNGGDLKFHIYNMGNPGFEEERALFYAAEILCGLE
DLHRENTVYRDLKPENILLDDYGHIRISDLGLAVKIPEGDLIRGRVGTVGYMAPEVLNNQ
RYGLSPDYWGLGCLIYEMIEGQSPFRGRKEKVKREEVDRRVLETEEVYSHKFSEEAKSIC
KMLLTKDAKQRLGCQEEGAAEVKRHPFFRNMNFKRLEAGMLDPPFVPDPRAVYCKDVLDI
EQFSTVKGVNLDHTDDDFYSKFSTGSVSIPWQNEMIETECFKELNVFGPNGTLPPDLNRN
HPPEPPKKGLLQRLFKRQHQNNSKSSPSSKTSFNHHINSNHVSSNSTGSS
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atggagctggaaaacatcgtggccaacacggtcttgctgaaagccagggaagggggcgga
ggaaagcgcaaagggaaaagcaagaagtggaaagaaatcctgaagttccctcacattagc
cagtgtgaagacctccgaaggaccatagacagagattactgcagtttatgtgacaagcag
ccaatcgggaggctgcttttccggcagttttgtgaaaccaggcctgggctggagtgttac
attcagttcctggactccgtggcagaatatgaagttactccagatgaaaaactgggagag
aaagggaaggaaattatgaccaagtacctcaccccaaagtcccctgttttcatagcccaa
gttggccaagacctggtctcccagacggaggagaagctcctacagaagccgtgcaaagaa
ctcttttctgcctgtgcacagtctgtccacgagtacctgaggggagaaccattccacgaa
tatctggacagcatgttttttgaccgctttctccagtggaagtggttggaaaggcaaccg
gtgaccaaaaacactttcaggcagtatcgagtgctaggaaaagggggcttcggggaggtc
tgtgcctgccaggttcgggccacgggtaaaatgtatgcctgcaagcgcttggagaagaag
aggatcaaaaagaggaaaggggagtccatggccctcaatgagaagcagatcctcgagaag
gtcaacagtcagtttgtggtcaacctggcctatgcctacgagaccaaggatgcactgtgc
ttggtcctgaccatcatgaatgggggtgacctgaagttccacatctacaacatgggcaac
cctggcttcgaggaggagcgggccttgttttatgcggcagagatcctctgcggcttagaa
gacctccaccgtgagaacaccgtctaccgagatctgaaacctgaaaacatcctgttagat
gattatggccacattaggatctcagacctgggcttggctgtgaagatccccgagggagac
ctgatccgcggccgggtgggcactgttggctacatggctccagaggtcctgaacaaccag
aggtacggcctgagccccgactactggggccttggctgcctcatctatgagatgatcgag
ggccagtcgccgttccgcggccgcaaggagaaggtgaagcgggaggaggtggaccgccgg
gtcctggagacggaggaggtgtactcccacaagttctccgaggaggccaagtccatctgc
aagatgctgctcacgaaagatgcgaagcagaggctgggctgccaggaggagggggctgca
gaggtcaagagacaccccttcttcaggaacatgaacttcaagcgcttagaagccgggatg
ttggaccctcccttcgttccagacccccgcgctgtgtactgtaaggacgtgctggacatc
gagcagttctccactgtgaagggcgtcaatctggaccacacagacgacgacttctactcc
aagttctccacgggctctgtgtccatcccatggcaaaacgagatgatagaaacagaatgc
tttaaggagctgaacgtgtttggacctaatggtaccctcccgccagatctgaacagaaac
caccctccggaaccgcccaagaaagggctgctccagagactcttcaagcggcagcatcag
aacaattccaagagttcgcccagctccaagaccagttttaaccaccacataaactcaaac
catgtcagctcgaactccaccggaagcagctag

DBGET integrated database retrieval system