KEGG   Homo sapiens (human): 2869Help
Entry
2869              CDS       T01001                                 

Gene name
GRK5, GPRK5
Definition
(RefSeq) G protein-coupled receptor kinase 5
  KO
K08291  G protein-coupled receptor kinase [EC:2.7.11.16]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04062  Chemokine signaling pathway
hsa04144  Endocytosis
hsa05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    2869 (GRK5)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    2869 (GRK5)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    2869 (GRK5)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.16  G-protein-coupled receptor kinase
     2869 (GRK5)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   2869 (GRK5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr RGS Kinase-like
Motif
Other DBs
NCBI-GeneID: 2869
NCBI-ProteinID: NP_005299
OMIM: 600870
HGNC: 4544
Ensembl: ENSG00000198873
Vega: OTTHUMG00000019149
Pharos: P34947(Tbio)
UniProt: P34947
Structure
PDB: 

Position
10q26.11
AA seq 590 aa AA seqDB search
MELENIVANTVLLKAREGGGGKRKGKSKKWKEILKFPHISQCEDLRRTIDRDYCSLCDKQ
PIGRLLFRQFCETRPGLECYIQFLDSVAEYEVTPDEKLGEKGKEIMTKYLTPKSPVFIAQ
VGQDLVSQTEEKLLQKPCKELFSACAQSVHEYLRGEPFHEYLDSMFFDRFLQWKWLERQP
VTKNTFRQYRVLGKGGFGEVCACQVRATGKMYACKRLEKKRIKKRKGESMALNEKQILEK
VNSQFVVNLAYAYETKDALCLVLTIMNGGDLKFHIYNMGNPGFEEERALFYAAEILCGLE
DLHRENTVYRDLKPENILLDDYGHIRISDLGLAVKIPEGDLIRGRVGTVGYMAPEVLNNQ
RYGLSPDYWGLGCLIYEMIEGQSPFRGRKEKVKREEVDRRVLETEEVYSHKFSEEAKSIC
KMLLTKDAKQRLGCQEEGAAEVKRHPFFRNMNFKRLEAGMLDPPFVPDPRAVYCKDVLDI
EQFSTVKGVNLDHTDDDFYSKFSTGSVSIPWQNEMIETECFKELNVFGPNGTLPPDLNRN
HPPEPPKKGLLQRLFKRQHQNNSKSSPSSKTSFNHHINSNHVSSNSTGSS
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atggagctggaaaacatcgtggccaacacggtcttgctgaaagccagggaagggggcgga
ggaaagcgcaaagggaaaagcaagaagtggaaagaaatcctgaagttccctcacattagc
cagtgtgaagacctccgaaggaccatagacagagattactgcagtttatgtgacaagcag
ccaatcgggaggctgcttttccggcagttttgtgaaaccaggcctgggctggagtgttac
attcagttcctggactccgtggcagaatatgaagttactccagatgaaaaactgggagag
aaagggaaggaaattatgaccaagtacctcaccccaaagtcccctgttttcatagcccaa
gttggccaagacctggtctcccagacggaggagaagctcctacagaagccgtgcaaagaa
ctcttttctgcctgtgcacagtctgtccacgagtacctgaggggagaaccattccacgaa
tatctggacagcatgttttttgaccgctttctccagtggaagtggttggaaaggcaaccg
gtgaccaaaaacactttcaggcagtatcgagtgctaggaaaagggggcttcggggaggtc
tgtgcctgccaggttcgggccacgggtaaaatgtatgcctgcaagcgcttggagaagaag
aggatcaaaaagaggaaaggggagtccatggccctcaatgagaagcagatcctcgagaag
gtcaacagtcagtttgtggtcaacctggcctatgcctacgagaccaaggatgcactgtgc
ttggtcctgaccatcatgaatgggggtgacctgaagttccacatctacaacatgggcaac
cctggcttcgaggaggagcgggccttgttttatgcggcagagatcctctgcggcttagaa
gacctccaccgtgagaacaccgtctaccgagatctgaaacctgaaaacatcctgttagat
gattatggccacattaggatctcagacctgggcttggctgtgaagatccccgagggagac
ctgatccgcggccgggtgggcactgttggctacatggctccagaggtcctgaacaaccag
aggtacggcctgagccccgactactggggccttggctgcctcatctatgagatgatcgag
ggccagtcgccgttccgcggccgcaaggagaaggtgaagcgggaggaggtggaccgccgg
gtcctggagacggaggaggtgtactcccacaagttctccgaggaggccaagtccatctgc
aagatgctgctcacgaaagatgcgaagcagaggctgggctgccaggaggagggggctgca
gaggtcaagagacaccccttcttcaggaacatgaacttcaagcgcttagaagccgggatg
ttggaccctcccttcgttccagacccccgcgctgtgtactgtaaggacgtgctggacatc
gagcagttctccactgtgaagggcgtcaatctggaccacacagacgacgacttctactcc
aagttctccacgggctctgtgtccatcccatggcaaaacgagatgatagaaacagaatgc
tttaaggagctgaacgtgtttggacctaatggtaccctcccgccagatctgaacagaaac
caccctccggaaccgcccaagaaagggctgctccagagactcttcaagcggcagcatcag
aacaattccaagagttcgcccagctccaagaccagttttaaccaccacataaactcaaac
catgtcagctcgaactccaccggaagcagctag

DBGET integrated database retrieval system