KEGG   Homo sapiens (human): 2873
Entry
2873              CDS       T01001                                 

Gene name
GPS1, COPS1, CSN1, SGN1
Definition
(RefSeq) G protein pathway suppressor 1
  KO
K12175  COP9 signalosome complex subunit 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    2873 (GPS1)
Ubiquitin system [BR:hsa04121]
 Deubiquitinating enzyme (DUB)
  UBL-specific proteases (ULPs)
   COP9 signalosome (CSN) complex
    2873 (GPS1)
SSDB
Motif
Pfam: RPN7 PCI TPR_2 TPR_11 GARP TPR_1
Other DBs
NCBI-GeneID: 2873
NCBI-ProteinID: NP_004118
OMIM: 601934
HGNC: 4549
Ensembl: ENSG00000169727
Vega: OTTHUMG00000178484
Pharos: Q13098(Tbio)
UniProt: Q13098
Structure
PDB: 

Position
17q25.3
AA seq 491 aa
MPLPVQVFNLQGAVEPMQIDVDPQEDPQNAPDVNYVVENPSLDLEQYAASYSGLMRIERL
QFIADHCPTLRVEALKMALSFVQRTFNVDMYEEIHRKLSEATRSSLRELQNAPDAIPESG
VEPPALDTAWVEATRKKALLKLEKLDTDLKNYKGNSIKESIRRGHDDLGDHYLDCGDLSN
ALKCYSRARDYCTSAKHVINMCLNVIKVSVYLQNWSHVLSYVSKAESTPEIAEQRGERDS
QTQAILTKLKCAAGLAELAARKYKQAAKCLLLASFDHCDFPELLSPSNVAIYGGLCALAT
FDRQELQRNVISSSSFKLFLELEPQVRDIIFKFYESKYASCLKMLDEMKDNLLLDMYLAP
HVRTLYTQIRNRALIQYFSPYVSADMHRMAAAFNTTVAALEDELTQLILEGLISARVDSH
SKILYARDVDQRSTTFEKSLLMGKEFQRRAKAMMLRAAVLRNQIHVKSPPREGSQGELTP
ANSQSRMSTNM
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgccgctgccggttcaggtgtttaacttgcagggggccgtggagcccatgcagatcgac
gtggacccccaggaagacccgcagaatgcacctgacgtcaactacgtggtggagaacccc
agcctggatctggaacagtacgcggccagctacagcggcctgatgcgcatcgaacggctg
cagttcattgctgatcactgccccacgctgcgggtggaggccctgaagatggccctctcc
ttcgtgcagagaacctttaacgtggacatgtacgaggagatccaccgcaagctctcagag
gccaccaggtcctctctcagggagctgcagaacgcacccgacgccatccctgagagcggc
gtggagcccccagccctggacacggcctgggtggaggccacgcggaagaaggcgctgctg
aagctggagaagctggacacagacctgaagaactacaagggcaactccatcaaagagagc
atccggcgcggccacgacgacctgggcgaccactacctggactgtggggacctcagcaac
gccctcaagtgctattcccgggcccgggactactgcaccagcgccaaacacgtcatcaac
atgtgcctcaatgtcatcaaggtcagcgtctacttgcagaattggtctcatgtgctcagc
tacgtcagcaaggctgagtccaccccagagattgccgagcagcgaggagagcgtgacagc
cagacccaggccatcctcaccaagctcaagtgtgccgcaggcttggcagagctggccgcc
aggaagtacaagcaggctgccaagtgcctcctgctggcttcctttgatcactgtgacttc
cctgagctgctgtcccccagcaacgtggccatctacggtggcctgtgcgccttggctacc
tttgaccggcaggagctgcagcgcaatgtcatctccagcagctccttcaagttgttcttg
gagctggagccacaggtccgagacatcatcttcaaattctacgagtccaagtacgcctca
tgtctcaagatgctggacgagatgaaggacaacctgctcctggacatgtatctggccccc
catgtcaggaccctgtacacccagattcgcaaccgtgccctcatccagtatttcagcccc
tacgtgtcagccgacatgcataggatggcggcagccttcaataccacggtggccgccctg
gaggacgagctgacgcagctaatcctggaggggctgatcagtgcccgtgtggactcacac
agcaagatcctatacgcccgggacgtggatcagcgcagcaccacctttgagaagtctctg
ttgatgggcaaggagttccagcgccgcgccaaggccatgatgctgcgggcagctgtgctc
cgcaaccagatccatgtcaagtccccgcccagagaagggagccagggggagctgactcca
gccaacagccagtcccggatgagcaccaacatgtga

DBGET integrated database retrieval system