KEGG   Homo sapiens (human): 2876
Entry
2876              CDS       T01001                                 

Gene name
GPX1, GPXD, GSHPX1
Definition
(RefSeq) glutathione peroxidase 1
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00590  Arachidonic acid metabolism
hsa01100  Metabolic pathways
hsa04918  Thyroid hormone synthesis
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05022  Pathways of neurodegeneration - multiple diseases
Network
nt06026  Glutathione biosynthesis
  Element
N00899  Glutathione biosynthesis
N00900  GPX1 deficiency in glutathione biosynthesis
Disease
H00668  Anemia due to disorders of glutathione metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    2876 (GPX1)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    2876 (GPX1)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    2876 (GPX1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    2876 (GPX1)
   05016 Huntington disease
    2876 (GPX1)
   05022 Pathways of neurodegeneration - multiple diseases
    2876 (GPX1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     2876 (GPX1)
SSDB
Motif
Pfam: GSHPx Redoxin AhpC-TSA
Other DBs
NCBI-GeneID: 2876
NCBI-ProteinID: NP_000572
OMIM: 138320
HGNC: 4553
Ensembl: ENSG00000233276
Vega: OTTHUMG00000156837
Pharos: P07203(Tbio)
UniProt: P07203 Q7L4Q3
Structure
PDB: 
2F8A

Position
3p21.31
AA seq 203 aa
MCAARLAAAAAAAQSVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLUGTTVRDYTQMN
ELQRRLGPRGLVVLGFPCNQFGHQENAKNEEILNSLKYVRPGGGFEPNFMLFEKCEVNGA
GAHPLFAFLREALPAPSDDATALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPLRRYS
RRFQTIDIEPDIEALLSQGPSCA
NT seq 612 nt   +upstreamnt  +downstreamnt
atgtgtgctgctcggctagcggcggcggcggcggcggcccagtcggtgtatgccttctcg
gcgcgcccgctggccggcggggagcctgtgagcctgggctccctgcggggcaaggtacta
cttatcgagaatgtggcgtccctctgaggcaccacggtccgggactacacccagatgaac
gagctgcagcggcgcctcggaccccggggcctggtggtgctcggcttcccgtgcaaccag
tttgggcatcaggagaacgccaagaacgaagagattctgaattccctcaagtacgtccgg
cctggtggtgggttcgagcccaacttcatgctcttcgagaagtgcgaggtgaacggtgcg
ggggcgcaccctctcttcgccttcctgcgggaggccctgccagctcccagcgacgacgcc
accgcgcttatgaccgaccccaagctcatcacctggtctccggtgtgtcgcaacgatgtt
gcctggaactttgagaagttcctggtgggccctgacggtgtgcccctacgcaggtacagc
cgccgcttccagaccattgacatcgagcctgacatcgaagccctgctgtctcaagggccc
agctgtgcctag

DBGET integrated database retrieval system