KEGG   Homo sapiens (human): 2878Help
Entry
2878              CDS       T01001                                 

Gene name
GPX3, GPx-P, GSHPx-3, GSHPx-P
Definition
(RefSeq) glutathione peroxidase 3
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00590  Arachidonic acid metabolism
hsa01100  Metabolic pathways
hsa04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    2878 (GPX3)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    2878 (GPX3)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    2878 (GPX3)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     2878 (GPX3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-GeneID: 2878
NCBI-ProteinID: NP_002075
OMIM: 138321
HGNC: 4555
Ensembl: ENSG00000211445
Vega: OTTHUMG00000163693
Pharos: P22352(Tbio)
UniProt: P22352
Structure
PDB: 

Position
5q33.1
AA seq 226 aa AA seqDB search
MARLLQASCLLSLLLAGFVSQSRGQEKSKMDCHGGISGTIYEYGALTIDGEEYIPFKQYA
GKYVLFVNVASYUGLTGQYIELNALQEELAPFGLVILGFPCNQFGKQEPGENSEILPTLK
YVRPGGGFVPNFQLFEKGDVNGEKEQKFYTFLKNSCPPTSELLGTSDRLFWEPMKVHDIR
WNFEKFLVGPDGIPIMRWHHRTTVSNVKMDILSYMRRQAALGVKRK
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggcccggctgctgcaggcgtcctgcctgctttccctgctcctggccggcttcgtctcg
cagagccggggacaagagaagtcgaagatggactgccatggtggcataagtggcaccatt
tacgagtacggagccctcaccattgatggggaggagtacatccccttcaagcagtatgct
ggcaaatacgtcctctttgtcaacgtggccagctactgaggcctgacgggccagtacatt
gaactgaatgcactacaggaagagcttgcaccattcggtctggtcattctgggctttccc
tgcaaccaatttggaaaacaggaaccaggagagaactcagagatccttcctaccctcaag
tatgtccgaccaggtggaggctttgtccctaatttccagctctttgagaaaggggatgtc
aatggagagaaagagcagaaattctacactttcctaaagaactcctgtcctcccacctcg
gagctcctgggtacatctgaccgcctcttctgggaacccatgaaggttcacgacatccgc
tggaactttgagaagttcctggtggggccagatggtatacccatcatgcgctggcaccac
cggaccacggtcagcaacgtcaagatggacatcctgtcctacatgaggcggcaggcagcc
ctgggggtcaagaggaagtaa

DBGET integrated database retrieval system