KEGG   Homo sapiens (human): 2882Help
Entry
2882              CDS       T01001                                 

Gene name
GPX7, CL683, GPX6, GPx-7, GSHPx-7, NPGPx
Definition
(RefSeq) glutathione peroxidase 7
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00590  Arachidonic acid metabolism
hsa04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    2882 (GPX7)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    2882 (GPX7)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    2882 (GPX7)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     2882 (GPX7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA SCO1-SenC Acyl-CoA_dh_C
Motif
Other DBs
NCBI-GeneID: 2882
NCBI-ProteinID: NP_056511
OMIM: 615784
HGNC: 4559
Ensembl: ENSG00000116157
Vega: OTTHUMG00000008322
Pharos: Q96SL4(Tbio)
UniProt: Q96SL4
Structure
PDB: 

Position
1p32.3
AA seq 187 aa AA seqDB search
MVAATVAAAWLLLWAAACAQQEQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFT
DQHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAV
TGTGAHPAFKYLAQTSGKEPTWNFWKYLVAPDGKVVGAWDPTVSVEEVRPQITALVRKLI
LLKREDL
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atggtggcggcgacggtggcagcggcgtggctgctcctgtgggctgcggcctgcgcgcag
caggagcaggacttctacgacttcaaggcggtcaacatccggggcaaactggtgtcgctg
gagaagtaccgcggatcggtgtccctggtggtgaatgtggccagcgagtgcggcttcaca
gaccagcactaccgagccctgcagcagctgcagcgagacctgggcccccaccactttaac
gtgctcgccttcccctgcaaccagtttggccaacaggagcctgacagcaacaaggagatt
gagagctttgcccgccgcacctacagtgtctcattccccatgtttagcaagattgcagtc
accggtactggtgcccatcctgccttcaagtacctggcccagacttctgggaaggagccc
acctggaacttctggaagtacctagtagccccagatggaaaggtggtaggggcttgggac
ccaactgtgtcagtggaggaggtcagaccccagatcacagcgctcgtgaggaagctcatc
ctactgaagcgagaagacttataa

DBGET integrated database retrieval system