KEGG   Homo sapiens (human): 2887
Entry
2887              CDS       T01001                                 

Gene name
GRB10, GRB-IR, Grb-10, IRBP, MEG1, RSS
Definition
(RefSeq) growth factor receptor bound protein 10
  KO
K20064  growth factor receptor-bound protein 10
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    2887 (GRB10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    2887 (GRB10)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Receptor tyrosine kinase (RTK) adaptor proteins
    2887 (GRB10)
SSDB
Motif
Pfam: BPS SH2 RA CCD48 PH
Other DBs
NCBI-GeneID: 2887
NCBI-ProteinID: NP_001001549
OMIM: 601523
HGNC: 4564
Ensembl: ENSG00000106070
Vega: OTTHUMG00000150622
Pharos: Q13322(Tbio)
UniProt: Q13322
Structure
PDB: 
1NRV 3HK0

Position
7p12.1
AA seq 548 aa
MALAGCPDSFLHHPYYQDKVEQTPRSQQDPAGPGLPAQSDRLANHQEDDVDLEALVNDMN
ASLESLYSACSMQSDTVPLLQNGQHARSQPRASGPPRSIQPQVSPRQRVQRSQPVHILAV
RRLQEEDQQFRTSSLPAIPNPFPELCGPGSPPVLTPGSLPPSQAAAKQDVKVFSEDGTSK
VVEILADMTARDLCQLLVYKSHCVDDNSWTLVEHHPHLGLERCLEDHELVVQVESTMASE
SKFLFRKNYAKYEFFKNPMNFFPEQMVTWCQQSNGSQTQLLQEPRHLQLLADLEDSNIFS
LIAGRKQYNAPTDHGLCIKPNKVRNETKELRLLCAEDEQTRTCWMTAFRLLKYGMLLYQN
YRIPQQRKALLSPFSTPVRSVSENSLVAMDFSGQTGRVIENPAEAQSAALEEGHAWRKRS
TRMNILGSQSPLHPSTLSTVIHRTQHWFHGRISREESHRIIKQQGLVDGLFLLRDSQSNP
KAFVLTLCHHQKIKNFQILPCEDDGQTFFSLDDGNTKFSDLIQLVDFYQLNKGVLPCKLK
HHCIRVAL
NT seq 1647 nt   +upstreamnt  +downstreamnt
atggctttagccggctgcccagattcctttttgcaccatccgtactaccaggacaaggtg
gagcagacacctcgcagtcaacaagacccggcaggaccaggactccccgcacagtctgac
cgacttgcgaatcaccaggaggatgatgtggacctggaagccctggtgaacgatatgaat
gcatccctggagagcctgtactcggcctgcagcatgcagtcagacacggtgcccctcctg
cagaatggccagcatgcccgcagccagcctcgggcttcaggccctcctcggtccatccag
ccacaggtgtccccgaggcagagggtgcagcgctcccagcctgtgcacatcctcgctgtc
aggcgccttcaggaggaagaccagcagtttagaacctcatctctgccggccatccccaat
ccttttcctgaactctgtggccctgggagcccccctgtgctcacgccgggttctttacct
ccgagccaggccgccgcaaagcaggatgttaaagtctttagtgaagatgggacaagcaaa
gtggtggagattctagcagacatgacagccagagacctgtgccaattgctggtttacaaa
agtcactgtgtggatgacaacagctggacactagtggagcaccacccgcacctaggatta
gagaggtgcttggaagaccatgagctggtggtccaggtggagagtaccatggccagtgag
agtaaatttctattcaggaagaattacgcaaaatacgagttctttaaaaatcccatgaat
ttcttcccagaacagatggttacttggtgccagcagtcaaatggcagtcaaacccagctt
ttgcaggaacccagacacctgcagctgctggccgacctggaggacagcaacatcttctcc
ctgatcgctggcaggaagcagtacaacgcccctacagaccacgggctctgcataaagcca
aacaaagtcaggaatgaaactaaagagctgaggttgctctgtgcagaggacgagcaaacc
aggacgtgctggatgacagcgttcagactcctcaagtatggaatgctcctttaccagaat
taccgaatccctcagcagaggaaggccttgctgtccccgttctcgacgccagtgcgcagt
gtctccgagaactccctcgtggcaatggatttttctgggcaaacaggacgcgtgatagag
aatccggcagaggcccagagcgcagccctggaggagggccacgcctggaggaagcgaagc
acacggatgaacatcctaggtagccaaagtcccctccacccttctaccctaagtacagtg
attcacaggacacagcactggtttcacgggaggatctccagggaggaatcccacaggatc
attaaacagcaagggctcgtggatgggctttttctcctccgtgacagccagagtaatcca
aaggcatttgtactcacactgtgtcatcaccagaaaattaaaaatttccagatcttacct
tgcgaggacgacgggcagacgttcttcagcctagatgacgggaacaccaaattctctgac
ctgatccagctggttgacttttaccagctgaacaaaggagtcctgccttgcaaactcaag
caccactgcatccgagtggccttatga

DBGET integrated database retrieval system