KEGG   Homo sapiens (human): 2888
Entry
2888              CDS       T01001                                 

Gene name
GRB14
Definition
(RefSeq) growth factor receptor bound protein 14
  KO
K23696   
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: BPS SH2 RA PH PH_9
Other DBs
NCBI-GeneID: 2888
NCBI-ProteinID: NP_004481
OMIM: 601524
HGNC: 4565
Ensembl: ENSG00000115290
Vega: OTTHUMG00000132135
Pharos: Q14449(Tbio)
UniProt: Q14449
Structure
PDB: 
2AUG 4K81 2AUH

Position
2q24.3
AA seq 540 aa
MTTSLQDGQSAASRAAARDSPLAAQVCGAAQGRGDAHDLAPAPWLHARALLPLPDGTRGC
AADRRKKKDLDVPEMPSIPNPFPELCCSPFTSVLSADLFPKANSRKKQVIKVYSEDETSR
ALDVPSDITARDVCQLLILKNHYIDDHSWTLFEHLPHIGVERTIEDHELVIEVLSNWGIE
EENKLYFRKNYAKYEFFKNPMYFFPEHMVSFATETNGEISPTQILQMFLSSSTYPEIHGF
LHAKEQGKKSWKKIYFFLRRSGLYFSTKGTSKEPRHLQFFSEFGNSDIYVSLAGKKKHGA
PTNYGFCFKPNKAGGPRDLKMLCAEEEQSRTCWVTAIRLLKYGMQLYQNYMHPYQGRSGC
SSQSISPMRSISENSLVAMDFSGQKSRVIENPTEALSVAVEEGLAWRKKGCLRLGTHGSP
TASSQSSATNMAIHRSQPWFHHKISRDEAQRLIIQQGLVDGVFLVRDSQSNPKTFVLSMS
HGQKIKHFQIIPVEDDGEMFHTLDDGHTRFTDLIQLVEFYQLNKGVLPCKLKHYCARIAL
NT seq 1623 nt   +upstreamnt  +downstreamnt
atgaccacttccctgcaagatgggcagagcgccgcgagcagggcggctgcccgggattcg
ccgctggccgcccaggtgtgtggcgctgcccaggggaggggcgacgcccacgacctggcg
ccggccccctggctgcacgcgcgagcgctcctgccccttccggacgggacccgcggctgt
gctgcagacaggagaaaaaagaaagatcttgatgttccggaaatgccatctattccaaac
ccttttcctgagctatgctgttctccatttacatctgtgttgtcagcagacctatttccc
aaagcaaattcaaggaaaaaacaggtgattaaagtatacagtgaagatgaaaccagcagg
gctttagatgtacccagtgacataacggctcgagatgtttgtcagctgttgatcctgaag
aatcattacattgatgaccacagctggaccctttttgagcacctgcctcacataggtgta
gaaagaacaatagaagaccacgaactggtgattgaagtgctatccaactgggggatagaa
gaagaaaacaaactatactttagaaaaaattatgccaaatatgagttctttaaaaaccca
atgtatttttttccagagcatatggtatcttttgcaactgaaaccaatggtgaaatatcc
cccacacagattttgcagatgtttctgagttcaagcacatatcctgaaattcatggtttc
ttacatgcgaaagaacagggaaagaagtcttggaaaaaaatttacttttttctaagaaga
tctggtttatatttttctactaaaggaacatcaaaggaaccgcggcatttgcagtttttc
agcgaatttggcaatagtgatatttatgtgtcactggcaggcaaaaaaaaacatggagca
ccgactaactatggattctgctttaagcctaacaaagcgggagggccccgagacctgaaa
atgctctgtgcagaagaagagcagagtaggacgtgctgggtgaccgcgattagattgctt
aagtatggcatgcagctgtaccagaattatatgcatccatatcaaggtagaagtggctgc
agttcacagagcatatcacctatgagaagtatatcagagaattccctggtagcaatggac
ttctcaggccagaaaagcagagttatagaaaatcccactgaagccctttcagttgcggtt
gaagaaggactcgcttggaggaaaaaaggatgtttacgcctgggcactcacggtagcccc
actgcctcttcacagagctctgccacaaacatggctatccaccggtcccagccatggttt
caccacaaaatttctagagatgaggctcagcgattgattattcagcaaggacttgtggat
ggagttttcttggtacgggatagtcagagtaaccccaaaactttcgtactgtcaatgagt
catggacaaaaaataaagcactttcaaattataccagtagaagatgacggtgaaatgttc
cacacactggatgatggccacacaagatttacagatctaatacagctggtggagttctat
caactcaataagggcgttcttccttgcaagttgaaacattattgtgctaggattgctctc
tag

DBGET integrated database retrieval system