KEGG   Homo sapiens (human): 2891Help
Entry
2891              CDS       T01001                                 

Gene name
GRIA2, GLUR2, GLURB, GluA2, GluR-K2, HBGR2
Definition
(RefSeq) glutamate ionotropic receptor AMPA type subunit 2
  KO
K05198  glutamate receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04713  Circadian entrainment
hsa04720  Long-term potentiation
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04728  Dopaminergic synapse
hsa04730  Long-term depression
hsa05014  Amyotrophic lateral sclerosis (ALS)
hsa05030  Cocaine addiction
hsa05031  Amphetamine addiction
hsa05033  Nicotine addiction
Drug target
Farampator: D04131
Mibampator: D09931
Perampanel (DG01901): D08964 D10780
Riluzole: D00775
Talampanel: D02696
Tezampanel: D06656
Topiramate: D00537
Zonampanel: D09035
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    2891 (GRIA2)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2891 (GRIA2)
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    2891 (GRIA2)
   04728 Dopaminergic synapse
    2891 (GRIA2)
   04720 Long-term potentiation
    2891 (GRIA2)
   04730 Long-term depression
    2891 (GRIA2)
   04723 Retrograde endocannabinoid signaling
    2891 (GRIA2)
  Environmental adaptation
   04713 Circadian entrainment
    2891 (GRIA2)
 Human Diseases
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    2891 (GRIA2)
  Substance dependence
   05030 Cocaine addiction
    2891 (GRIA2)
   05031 Amphetamine addiction
    2891 (GRIA2)
   05033 Nicotine addiction
    2891 (GRIA2)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   2891 (GRIA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 Peripla_BP_6
Motif
Other DBs
NCBI-GeneID: 2891
NCBI-ProteinID: NP_000817
OMIM: 138247
HGNC: 4572
Ensembl: ENSG00000120251
Vega: OTTHUMG00000133836
Pharos: P42262(Tclin)
UniProt: P42262
Structure
PDB: 

Position
4q32.1
AA seq 883 aa AA seqDB search
MQKIMHISVLLSPVLWGLIFGVSSNSIQIGGLFPRGADQEYSAFRVGMVQFSTSEFRLTP
HIDNLEVANSFAVTNAFCSQFSRGVYAIFGFYDKKSVNTITSFCGTLHVSFITPSFPTDG
THPFVIQMRPDLKGALLSLIEYYQWDKFAYLYDSDRGLSTLQAVLDSAAEKKWQVTAINV
GNINNDKKDEMYRSLFQDLELKKERRVILDCERDKVNDIVDQVITIGKHVKGYHYIIANL
GFTDGDLLKIQFGGANVSGFQIVDYDDSLVSKFIERWSTLEEKEYPGAHTTTIKYTSALT
YDAVQVMTEAFRNLRKQRIEISRRGNAGDCLANPAVPWGQGVEIERALKQVQVEGLSGNI
KFDQNGKRINYTINIMELKTNGPRKIGYWSEVDKMVVTLTELPSGNDTSGLENKTVVVTT
ILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKI
WNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLD
PLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEFEDGRETQSSESTNEFGIFNSLWF
SLGAFMRQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDL
SKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGK
YAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLRTPVNLAVLKLSEQGVL
DKLKNKWWYDKGECGAKDSGSKEKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSR
AEAKRMKVAKNAQNINPSSSQNSQNFATYKEGYNVYGIESVKI
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagattatgcatatttctgtcctcctttctcctgttttatggggactgattttt
ggtgtctcttctaacagcatacagataggggggctatttcctaggggcgccgatcaagaa
tacagtgcatttcgagtagggatggttcagttttccacttcggagttcagactgacaccc
cacatcgacaatttggaggtggcaaacagcttcgcagtcactaatgctttctgctcccag
ttttcgagaggagtctatgctatttttggattttatgacaagaagtctgtaaataccatc
acatcattttgcggaacactccacgtctccttcatcactcccagcttcccaacagatggc
acacatccatttgtcattcagatgagacccgacctcaaaggagctctccttagcttgatt
gaatactatcaatgggacaagtttgcatacctctatgacagtgacagaggcttatcaaca
ctgcaagctgtgctggattctgctgctgaaaagaaatggcaagtgactgctatcaatgtg
ggaaacattaacaatgacaagaaagatgagatgtaccgatcactttttcaagatctggag
ttaaaaaaggaacggcgtgtaattctggactgtgaaagggataaagtaaacgacattgta
gaccaggttattaccattggaaaacatgttaaagggtaccactacatcattgcaaatctg
ggatttactgatggagacctattaaaaatccagtttggaggtgcaaatgtctctggattt
cagatagtggactatgatgattcgttggtatctaaatttatagaaagatggtcaacactg
gaagaaaaagaataccctggagctcacacaacaacaattaagtatacttctgctctgacc
tatgatgccgttcaagtgatgactgaagccttccgcaacctaaggaagcaaagaattgaa
atctcccgaagggggaatgcaggagactgtctggcaaacccagcagtgccctggggacaa
ggtgtagaaatagaaagggccctcaaacaggttcaggttgaaggtctctcaggaaatata
aagtttgaccagaatggaaaaagaataaactatacaattaacatcatggagctcaaaact
aatgggccccggaagattggctactggagtgaagtggacaaaatggttgttacccttact
gagctcccttctggaaatgacacctctgggcttgagaataagactgttgttgtcaccaca
attttggaatctccgtatgttatgatgaagaaaaatcatgaaatgcttgaaggcaatgag
cgctatgagggctactgtgttgacctggctgcagaaatcgccaaacattgtgggttcaag
tacaagttgacaattgttggtgatggcaagtatggggccagggatgcagacacgaaaatt
tggaatgggatggttggagaacttgtatatgggaaagctgatattgcaattgctccatta
actattacccttgtgagagaagaggtgattgacttctcaaagcccttcatgagcctcggg
atatctatcatgatcaagaagcctcagaagtccaaaccaggagtgttttcctttcttgat
cctttagcctatgagatctggatgtgcattgtttttgcctacattggggtcagtgtagtt
ttattcctggtcagcagatttagcccctacgagtggcacactgaggagtttgaagatgga
agagaaacacaaagtagtgaatcaactaatgaatttgggatttttaatagtctctggttt
tccttgggtgcctttatgcggcaaggatgcgatatttcgccaagatccctctctgggcgc
attgttggaggtgtgtggtggttctttaccctgatcataatctcctcctacacggctaac
ttagctgccttcctgactgtagagaggatggtgtctcccatcgaaagtgctgaggatctt
tctaagcaaacagaaattgcttatggaacattagactctggctccactaaagagtttttc
aggagatctaaaattgcagtgtttgataaaatgtggacctacatgcggagtgcggagccc
tctgtgtttgtgaggactacggccgaaggggtggctagagtgcggaagtccaaagggaaa
tatgcctacttgttggagtccacgatgaacgagtacattgagcaaaggaagccttgcgac
accatgaaagttggtggaaacctggattccaaaggctatggcatcgcaacacctaaagga
tcctcattaagaaccccagtaaatcttgcagtattgaaactcagtgagcaaggcgtctta
gacaagctgaaaaacaaatggtggtacgataaaggtgaatgtggagccaaggactctgga
agtaaggaaaagaccagtgccctcagtctgagcaacgttgctggagtattctacatcctt
gtcgggggccttggtttggcaatgctggtggctttgattgagttctgttacaagtcaagg
gccgaggcgaaacgaatgaaggtggcaaagaatgcacagaatattaacccatcttcctcg
cagaattcacagaattttgcaacttataaggaaggttacaacgtatatggcatcgaaagt
gttaaaatttag

DBGET integrated database retrieval system