KEGG   Homo sapiens (human): 2894Help
Entry
2894              CDS       T01001                                 

Gene name
GRID1, GluD1
Definition
(RefSeq) glutamate ionotropic receptor delta type subunit 1
  KO
K05206  glutamate receptor delta-1 subunit
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2894 (GRID1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    2894 (GRID1)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   2894 (GRID1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 Peripla_BP_6
Motif
Other DBs
NCBI-GeneID: 2894
NCBI-ProteinID: NP_060021
OMIM: 610659
HGNC: 4575
Ensembl: ENSG00000182771
Vega: OTTHUMG00000018650
Pharos: Q9ULK0(Tbio)
UniProt: Q9ULK0 A8KAN9
Position
10q23.1-q23.2
AA seq 1009 aa AA seqDB search
MEALTLWLLPWICQCVSVRADSIIHIGAIFEENAAKDDRVFQLAVSDLSLNDDILQSEKI
TYSIKVIEANNPFQAVQEACDLMTQGILALVTSTGCASANALQSLTDAMHIPHLFVQRNP
GGSPRTACHLNPSPDGEAYTLASRPPVRLNDVMLRLVTELRWQKFVMFYDSEYDIRGLQS
FLDQASRLGLDVSLQKVDKNISHVFTSLFTTMKTEELNRYRDTLRRAILLLSPQGAHSFI
NEAVETNLASKDSHWVFVNEEISDPEILDLVHSALGRMTVVRQIFPSAKDNQKCTRNNHR
ISSLLCDPQEGYLQMLQISNLYLYDSVLMLANAFHRKLEDRKWHSMASLNCIRKSTKPWN
GGRSMLDTIKKGHITGLTGVMEFREDSSNPYVQFEILGTTYSETFGKDMRKLATWDSEKG
LNGSLQERPMGSRLQGLTLKVVTVLEEPFVMVAENILGQPKRYKGFSIDVLDALAKALGF
KYEIYQAPDGRYGHQLHNTSWNGMIGELISKRADLAISAITITPERESVVDFSKRYMDYS
VGILIKKPEEKISIFSLFAPFDFAVWACIAAAIPVVGVLIFVLNRIQAVRAQSAAQPRPS
ASATLHSAIWIVYGAFVQQGGESSVNSMAMRIVMGSWWLFTLIVCSSYTANLAAFLTVSR
MDNPIRTFQDLSKQVEMSYGTVRDSAVYEYFRAKGTNPLEQDSTFAELWRTISKNGGADN
CVSSPSEGIRKAKKGNYAFLWDVAVVEYAALTDDDCSVTVIGNSISSKGYGIALQHGSPY
RDLFSQRILELQDTGDLDVLKQKWWPHMGRCDLTSHASAQADGKSLKLHSFAGVFCILAI
GLLLACLVAALELWWNSNRCHQETPKEDKEVNLEQVHRRMNSLMDEDIAHKQISPASIEL
SALEMGGLAPTQTLEPTREYQNTQLSVSTFLPEQSSHGTSRTLSSGPSSNLPLPLSSSAT
MPSMQCKHRSPNGGLFRQSPVKTPIPMSFQPVPGGVLPEALDTSHGTSI
NT seq 3030 nt NT seq  +upstreamnt  +downstreamnt
atggaagcgctgacgctgtggcttctcccctggatatgccagtgcgtgtcggtgcgggcc
gactccatcatccacatcggtgccatcttcgaggagaacgcggccaaggacgacagggtg
ttccagttggcggtatccgacctgagcctcaacgatgacatcctgcagagcgagaagatc
acctactccatcaaggtcatcgaggccaacaacccattccaggctgtgcaggaagcctgt
gacctcatgacccaggggattttggccttggtcacgtccactggctgtgcatctgccaat
gccctgcagtccctcacggatgccatgcacatcccacacctctttgtccagcgcaacccg
ggagggtcgccacgcaccgcatgccacctgaaccccagccccgatggtgaggcctacaca
ctggcttcgagaccacccgtccgcctcaatgatgtcatgctcaggctggtgacggagctg
cgctggcagaagttcgtcatgttctacgacagcgagtatgatatccgtgggcttcaaagc
tttctggaccaggcctcgcggctgggccttgacgtctctttacaaaaggtggacaagaac
attagccacgtattcaccagcctcttcaccacgatgaagacagaggagctgaatcgctac
cgggacacgcttcgccgcgccatcctgctgctcagcccacagggagcccactccttcatc
aacgaggccgtggagaccaacctggcttccaaggacagccactgggtctttgtgaatgag
gaaatcagtgacccggagatcctggatctggtccatagtgcccttggaaggatgaccgtg
gtccggcaaatctttccgtctgcaaaggacaatcagaaatgcacgaggaacaaccaccgc
atctcctccctgctctgcgacccccaggaaggctacctccagatgctgcagatctccaac
ctctatctgtatgacagtgttctgatgctggccaacgcctttcacaggaagctggaggac
cggaagtggcatagcatggcgagcctcaactgcatacggaaatccactaagccatggaat
ggtgggaggtccatgctggataccatcaaaaagggccacatcactggcctcactggggtg
atggagtttcgggaggacagttcgaatccctatgtccagtttgaaatccttggcactacc
tatagtgagacttttggcaaagacatgcgcaagttggcgacatgggactcagagaagggc
ttgaatggcagcttgcaagagaggcccatgggcagccgcctccaaggattgactcttaaa
gtggtgactgtcttggaagagcctttcgtgatggtggctgagaacatcctaggacagccc
aagcgctacaaagggttctccatagatgtcctggatgcactggccaaggctctgggcttt
aaatatgagatttaccaagcccctgatggcaggtacggtcaccagctccataacacctcc
tggaacgggatgatcggggagctcatcagcaagagagcagacttggccatctctgccatc
accatcaccccagagagggagagcgttgtggacttcagcaagcggtacatggactattca
gtggggattctaattaagaagcccgaggagaaaatcagcatcttctccctctttgctcca
tttgatttcgctgtgtgggcctgcattgcagcagccatccctgtggttggtgtgctgata
tttgtgttgaacaggatacaggctgtgagggctcagagtgctgcccagcccaggccgtca
gcttctgccactctgcacagcgccatctggattgtctatggagccttcgtacagcaaggt
ggcgaatcttccgtgaactccatggccatgcgcatcgtgatgggcagctggtggctcttc
acgctcattgtgtgctcctcctacacagccaaccttgctgccttcctcacagtgtccagg
atggacaaccccataaggactttccaggacctgtccaaacaagtggaaatgtcttatggc
actgtccgggattctgctgtatatgagtacttccgagccaagggcaccaaccccctggag
caggacagcacgtttgctgaactctggcggaccatcagcaagaacggaggggctgacaac
tgcgtgtccagtccttcagaaggcatcaggaaggcaaagaaggggaactacgccttcctg
tgggatgtggccgtggtggaatacgcagccctgacggatgacgactgctcggtgactgtc
atcggcaacagcatcagcagcaagggttacgggattgccctgcagcatggcagcccctac
agggacctcttctcccagaggatcctggagctgcaggacacaggggacctggatgtgctg
aagcagaagtggtggccgcacatgggccgctgtgacctcaccagccatgccagcgcccag
gccgacggcaaatccctcaagctgcacagcttcgccggggtcttctgcatcctggccatt
ggcctgctcctggcctgcctggtggctgccctggagttgtggtggaacagcaaccggtgc
caccaggagacccccaaggaggacaaagaagtgaacttggagcaggtccaccggcgcatg
aacagcctcatggatgaagacattgctcacaagcagatttccccagcgtcgattgagctc
tcggccctggagatggggggcctggctcccacccagaccttggagccgacacgggagtac
cagaacacccagctctcggtcagcacctttctgccagagcagagcagccatggcaccagc
cggacactctcatcagggcccagcagcaacctgccgctgccgctgagcagctcggcgacc
atgccctccatgcagtgcaaacacaggtcacccaacggggggctgttccggcagagcccg
gtgaagacccccatccccatgtccttccagcccgtgcctggaggcgtccttccagaggct
ctggacacctcccacgggacctccatctga

DBGET integrated database retrieval system