KEGG   Homo sapiens (human): 2895
Entry
2895              CDS       T01001                                 

Gene name
GRID2, GluD2, SCAR18
Definition
(RefSeq) glutamate ionotropic receptor delta type subunit 2
  KO
K05207  glutamate receptor delta-2 subunit
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04730  Long-term depression
Disease
H01891  Autosomal recessive spinocerebellar ataxias
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2895 (GRID2)
 09150 Organismal Systems
  09156 Nervous system
   04730 Long-term depression
    2895 (GRID2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    2895 (GRID2)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   2895 (GRID2)
SSDB
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 Desmo_N RNase_H
Other DBs
NCBI-GeneID: 2895
NCBI-ProteinID: NP_001501
OMIM: 602368
HGNC: 4576
Ensembl: ENSG00000152208
Vega: OTTHUMG00000130975
Pharos: O43424(Tbio)
UniProt: O43424
Structure
PDB: 
5KC8 5KCA

Position
4q22.1-q22.2
AA seq 1007 aa
MEVFPFLLVLSVWWSRTWDSANADSIIHIGAIFDESAKKDDEVFRTAVGDLNQNEEILQT
EKITFSVTFVDGNNPFQAVQEACELMNQGILALVSSIGCTSAGSLQSLADAMHIPHLFIQ
RSTAGTPRSGCGLTRSNRNDDYTLSVRPPVYLHDVILRVVTEYAWQKFIIFYDSEYDIRG
IQEFLDKVSQQGMDVALQKVENNINKMITTLFDTMRIEELNRYRDTLRRAILVMNPATAK
SFITEVVETNLVAFDCHWIIINEEINDVDVQELVRRSIGRLTIIRQTFPVPQNISQRCFR
GNHRISSTLCDPKDPFAQNMEISNLYIYDTVLLLANAFHKKLEDRKWHSMASLSCIRKNS
KPWQGGRSMLETIKKGGVSGLTGELEFGENGGNPNVHFEILGTNYGEELGRGVRKLGCWN
PVTGLNGSLTDKKLENNMRGVVLRVVTVLEEPFVMVSENVLGKPKKYQGFSIDVLDALSN
YLGFNYEIYVAPDHKYGSPQEDGTWNGLVGELVFKRADIGISALTITPDRENVVDFTTRY
MDYSVGVLLRRAEKTVDMFACLAPFDLSLWACIAGTVLLVGLLVYLLNWLNPPRLQMGSM
TSTTLYNSMWFVYGSFVQQGGEVPYTTLATRMMMGAWWLFALIVISSYTANLAAFLTITR
IESSIQSLQDLSKQTEIPYGTVLDSAVYEHVRMKGLNPFERDSMYSQMWRMINRSNGSEN
NVLESQAGIQKVKYGNYAFVWDAAVLEYVAINDPDCSFYTIGNTVADRGYGIALQHGSPY
RDVFSQRILELQQNGDMDILKHKWWPKNGQCDLYSSVDTKQKGGALDIKSFAGVFCILAA
GIVLSCFIAMLETWWNKRKGSRVPSKEDDKEIDLEHLHRRVNSLCTDDDSPHKQFSTSSI
DLTPLDIDTLPTRQALEQISDFRNTHITTTTFIPEQIQTLSRTLSAKAASGFTFGNVPEH
RTGPFRHRAPNGGFFRSPIKTMSSIPYQPTPTLGLNLGNDPDRGTSI
NT seq 3024 nt   +upstreamnt  +downstreamnt
atggaagttttcccctttctcttggttttgtccgtctggtggtctcgaacctgggactcg
gcgaatgcggattcgatcattcacatcggagcaatttttgatgaatctgccaaaaaggat
gatgaggtatttcgcactgcggttggtgaccttaaccagaatgaggagatcttacagact
gagaaaatcacattttcagtgacgtttgttgatggcaacaaccctttccaagcagttcaa
gaagcctgtgaacttatgaatcaaggcatcttggccctggtcagctccattggctgcacg
tcagcaggatccctccagtctttggcagacgccatgcatatcccccacctcttcattcag
cgctcaacagctgggaccccaaggagtggctgtggactcacccggagcaacaggaatgat
gactacactctctcagttcgcccacctgtctacttgcatgatgttatcctaagagtggtc
acagagtatgcctggcagaaattcattatattctatgatagtgaatacgatatccgtgga
atacaggagttcttggacaaagtctctcagcagggaatggatgttgcacttcagaaggta
gaaaacaacatcaataaaatgattaccactctctttgacaccatgagaatagaagaactg
aatcgctatcgagacactcttaggcgagcgatccttgttatgaatcctgctacagccaaa
tccttcattactgaggttgtggagactaatttggttgcttttgactgtcactggatcatt
ataaatgaggaaataaacgatgtggacgtacaggaacttgtaagaaggtcaattggaagg
ttaacgattattcggcagacatttccagttccccagaacataagtcagcggtgtttccgt
ggcaaccatcgaatatcttcaacattgtgtgatccaaaggatccatttgctcagaatatg
gagatttccaacctttacatatatgacacggtgcttctgcttgctaatgcttttcataag
aagctggaggaccgaaagtggcacagcatggcaagtctgtcatgtatcagaaagaactca
aagccctggcagggtgggcgctccatgttggagaccatcaagaagggtggagttagtggg
ttgactggagagctagaatttggagaaaatggaggcaatcccaatgtccactttgaaatc
cttggaaccaactatggagaagagcttggcagaggtgttcgaaaacttggttgctggaat
cctgtcacaggtctgaatgggtcactgactgacaagaaattggagaataacatgcgtgga
gtggttctacgtgtagtaactgttctggaagaaccttttgtgatggtctctgaaaatgtc
ttgggtaagccgaagaaataccagggcttctccattgatgttttggatgccttatctaac
tacctgggttttaactacgaaatttacgtagcaccggatcacaaatacggaagcccacaa
gaagatgggacatggaatggcttggtaggagaacttgtctttaagagagccgacataggg
atttctgctttaaccatcactccagatcgtgaaaatgtggtggactttacgacacgttac
atggactactcagtgggggtactacttcgaagggctgaaaagacagtggatatgtttgcc
tgtcttgcaccatttgatctctctctatgggcttgcattgctggcacagtccttctggtg
ggtctactggtctacctcttgaactggcttaatcccccacgattacaaatgggatcaatg
acgtctactactctctacaactccatgtggtttgtgtatggatcttttgtacaacaaggc
ggggaagtcccgtacacgactctggctacccgaatgatgatgggggcttggtggctattt
gctttgattgttatctcatcttacacggcaaacctcgctgctttcctcactattacacgc
attgaaagttccatccagtctctccaggacctttccaagcaaacagaaatcccttatggc
acagtcctagactctgcggtatatgagcatgtccgcatgaaaggactgaatccttttgag
agggacagcatgtattcccaaatgtggcggatgatcaaccgaagcaatggatcggagaac
aatgttctggagtcccaggcaggcattcaaaaggtaaaatatggaaattatgctttcgta
tgggatgcagctgtattggaatatgtggctatcaatgacccagattgttccttttacacc
attggaaatactgttgctgatcggggatatggaattgcattacaacatggcagtccttac
cgagatgttttttcacaaaggatcctggagcttcagcagaatggtgacatggacatcctg
aagcacaaatggtggcctaagaatggccagtgtgacctgtactcgtcagtggacacaaag
cagaaaggaggcgccctggacataaagagctttgcaggggtcttttgtatcctggctgct
ggaattgtcctctcctgcttcatagccatgctggagacgtggtggaacaagaggaaaggc
tcccgggttccatcaaaagaggatgacaaggaaattgacctggagcacctccatagacgt
gtaaatagcttgtgcacagatgacgacagcccccataaacagttttccacctcgtcaatt
gatttgacccctctggacattgacactttgccaacacgacaagcactggagcaaatcagt
gatttcaggaacactcatattaccacaacaacctttatcccagagcagatccagactctt
agccgcacactgtcagctaaagctgcttctggtttcacttttggcaacgtgcctgagcac
cgaactggcccttttaggcacagggcacctaatgggggctttttcaggagtcctataaaa
acaatgtcatctattccttatcaaccaactcctaccctggggctcaatctgggtaatgat
ccagaccgaggcacctccatatga

DBGET integrated database retrieval system