KEGG   Homo sapiens (human): 28952Help
Entry
28952             CDS       T01001                                 

Gene name
CCDC22, CXorf37, JM1, RTSC2
Definition
(RefSeq) coiled-coil domain containing 22
  KO
K23343  coiled-coil domain-containing protein 22
Organism
hsa  Homo sapiens (human)
Disease
H01568  3C syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    28952 (CCDC22)
   04121 Ubiquitin system [BR:hsa04121]
    28952 (CCDC22)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Others
   Others
    28952 (CCDC22)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Multi subunit type E3 associated proteins
    28952 (CCDC22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF812 FAP206 DNA_topoisoIV Hemerythrin
Motif
Other DBs
NCBI-GeneID: 28952
NCBI-ProteinID: NP_054727
OMIM: 300859
HGNC: 28909
Ensembl: ENSG00000101997
Vega: OTTHUMG00000024141
Pharos: O60826(Tbio)
UniProt: O60826 A0A024QZ03
Position
Xp11.23
AA seq 627 aa AA seqDB search
MEEADRILIHSLRQAGTAVPPDVQTLRAFTTELVVEAVVRCLRVINPAVGSGLSPLLPLA
MSARFRLAMSLAQACMDLGYPLELGYQNFLYPSEPDLRDLLLFLAERLPTDASEDADQPA
GDSAILLRAIGSQIRDQLALPWVPPHLRTPKLQHLQGSALQKPFHASRLVVPELSSRGEP
REFQASPLLLPVPTQVPQPVGRVASLLEHHALQLCQQTGRDRPGDEDWVHRTSRLPPQED
TRAQRQRLQKQLTEHLRQSWGLLGAPIQARDLGELLQAWGAGAKTGAPKGSRFTHSEKFT
FHLEPQAQATQVSDVPATSRRPEQVTWAAQEQELESLREQLEGVNRSIEEVEADMKTLGV
SFVQAESECRHSKLSTAEREQALRLKSRAVELLPDGTANLAKLQLVVENSAQRVIHLAGQ
WEKHRVPLLAEYRHLRKLQDCRELESSRRLAEIQELHQSVRAAAEEARRKEEVYKQLMSE
LETLPRDVSRLAYTQRILEIVGNIRKQKEEITKILSDTKELQKEINSLSGKLDRTFAVTD
ELVFKDAKKDDAVRKAYKYLAALHENCSQLIQTIEDTGTIMREVRDLEEQIETELGKKTL
SNLEKIREDYRALRQENAGLLGRVREA
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atggaggaggcggaccgaatcctcatccattcgctgcgccaggccggcacggcagttcct
ccagatgtgcagaccttgcgcgccttcaccactgagctggttgtagaggctgtggtccgc
tgcctgcgtgtgatcaaccctgcggtgggctctggcctcagccctctgctgcctcttgcc
atgtctgcccggttccgcctggccatgagcctggctcaggcctgcatggacctgggctat
cccttggagcttggctatcagaacttcctctaccccagtgagcctgacctccgagacctg
cttctcttcttggctgagcgtctgcccaccgatgcctctgaggatgcagaccagcctgca
ggtgactcagctattctcctccgggccattgggagccaaattcgggaccagctggcactg
ccttgggtcccgccccaccttcgcactcccaagctgcagcacctccagggctcggccctc
cagaagcctttccatgccagcaggctggtcgtgccagaattgagttccagaggtgagcca
cgggagttccaggcgagtcccctgctgcttccagtccctacccaggtgcctcagcctgtt
ggaagggtggcctcgctcctcgaacaccatgccctgcagctctgccagcagacgggccgg
gaccggccaggggatgaggactgggtccaccggacatcccgcctcccaccccaggaggac
acacgggctcagcggcagcggctgcaaaagcaactgactgagcatctgcgccaaagctgg
ggcctgcttggggcccccatacaagcccgggacctgggagaactgctgcaggcctggggt
gctggggccaagactggtgctcctaagggctcccgcttcacgcactcagagaagttcacc
ttccatctggagccccaggcccaggccactcaggtgtcagatgtgccagccacctcccgg
cggcctgaacaggtcacgtgggcagctcaggaacaggagctcgagtcccttcgggagcag
ctggaaggagtgaaccgcagcattgaggaggttgaggccgacatgaagaccctgggcgtc
agctttgtgcaggcagagtctgagtgccggcacagcaagctcagtacagcagagcgtgag
caggccctgcgcctgaagagccgcgcggtggagctgctgcccgatgggactgccaacctt
gccaagctgcagcttgtggtggagaatagtgcccagcgggtcatccacttggcgggtcag
tgggagaagcaccgggtcccactcctcgctgagtaccgccacctccgaaagctgcaggat
tgcagagagctggaatcttctcgacggctggcagagatccaagaactgcaccagagtgtc
cgggcggctgctgaagaggcccgcaggaaggaggaggtctataagcagctgatgtcagag
ctggagactctgcccagagatgtgtcccggctggcctacacccagcgcatcctggagatc
gtgggcaacatccggaagcagaaggaagagatcaccaagatcttgtctgatacgaaggag
cttcagaaggaaatcaactccctatctgggaagctggaccggacgtttgcggtgactgat
gagcttgtgttcaaggatgccaagaaggacgatgctgttcggaaggcctataagtatcta
gctgctctgcacgagaactgcagccagctcatccagaccatcgaggacacaggcaccatc
atgcgggaggttcgagacctcgaggagcagatcgagacagagctgggcaagaagaccctc
agcaacctggagaagatccgggaggactaccgagccctccgccaggagaacgctggcctc
ctaggccgggtccgggaggcctga

DBGET integrated database retrieval system