KEGG   Homo sapiens (human): 28956Help
Entry
28956             CDS       T01001                                 

Gene name
LAMTOR2, ENDAP, HSPC003, MAPBPIP, MAPKSP1AP, ROBLD3, Ragulator2, p14
Definition
(RefSeq) late endosomal/lysosomal adaptor, MAPK and MTOR activator 2
  KO
K20398  ragulator complex protein LAMTOR2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
Disease
H01218  P14 deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    28956 (LAMTOR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Robl_LC7
Motif
Other DBs
NCBI-GeneID: 28956
NCBI-ProteinID: NP_054736
OMIM: 610389
HGNC: 29796
Ensembl: ENSG00000116586
Vega: OTTHUMG00000017462
Pharos: Q9Y2Q5(Tbio)
UniProt: Q9Y2Q5
Structure
PDB: 

Position
1q22
AA seq 125 aa AA seqDB search
MLRPKALTQVLSQANTGGVQSTLLLNNEGSLLAYSGYGDTDARVTAAIASNIWAAYDRNG
NQAFNEDNLKFILMDCMEGRVAITRVANLLLCMYAKETVGFGMLKAKAQALVQYLEEPLT
QVAAS
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgccccaaggctttgacccaggtgctaagccaagccaacactggaggcgtccag
agcaccctgctgctgaataacgagggatcactgctggcctactctggttacggggacact
gacgcccgggtcaccgctgccatagccagtaacatctgggccgcctacgaccggaacggg
aaccaagcgtttaatgaagacaatctcaaattcatcctcatggactgcatggagggccgt
gtagccatcacccgagtggccaaccttctgctgtgtatgtatgccaaggagaccgtgggc
tttggaatgctcaaggccaaggcccaggctttggtgcagtacctggaggagcccctcacc
caagtggcggcatcttaa

DBGET integrated database retrieval system