KEGG   Homo sapiens (human): 28958Help
Entry
28958             CDS       T01001                                 

Gene name
COA3, CCDC56, COX25, HSPC009, MITRAC12
Definition
(RefSeq) cytochrome c oxidase assembly factor 3
  KO
K18175  cytochrome c oxidase assembly factor 3, animal type
Organism
hsa  Homo sapiens (human)
Pathway
hsa04714  Thermogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    28958 (COA3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    28958 (COA3)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    28958 (COA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Coiled-coil_56 Cyt_b-c1_8
Motif
Other DBs
NCBI-GeneID: 28958
NCBI-ProteinID: NP_001035521
OMIM: 614775
HGNC: 24990
Ensembl: ENSG00000183978
Vega: OTTHUMG00000180651
Pharos: Q9Y2R0(Tbio)
UniProt: Q9Y2R0 A0A024R1X4
Position
17q21.2
AA seq 106 aa AA seqDB search
MASSGAGDPLDSKRGEAPFAQRIDPTREKLTPEQLHSMRQAELAQWQKVLPRRRTRNIVT
GLGIGALVLAIYGYTFYSISQERFLDELEDEAKAARARALARASGS
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcttcgggagctggtgaccctctggattctaagcgtggagaggccccgttcgct
cagcgtatcgacccgactcgggagaagctgacacccgagcaactgcattccatgcggcag
gcggagcttgcccagtggcagaaggtcctaccacggcggcgaacccggaacatcgtgacc
ggcctaggcatcggggccctggtgttggctatttatggttacaccttctactcgatttcc
caggagcgtttcctagatgagctagaagacgaggccaaagctgcccgagcccgagctctg
gcaagggcgtcagggtcctaa

DBGET integrated database retrieval system