KEGG   Homo sapiens (human): 2896
Entry
2896              CDS       T01001                                 

Gene name
GRN, CLN11, GEP, GP88, PCDGF, PEPI, PGRN
Definition
(RefSeq) granulin precursor
  KO
K23879  progranulin
Organism
hsa  Homo sapiens (human)
Disease
H00078  Frontotemporal lobar degeneration
H00149  Neuronal ceroid lipofuscinosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    2896 (GRN)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Others
   Others
    2896 (GRN)
SSDB
Motif
Pfam: Granulin
Other DBs
NCBI-GeneID: 2896
NCBI-ProteinID: NP_002078
OMIM: 138945
HGNC: 4601
Ensembl: ENSG00000030582
Vega: OTTHUMG00000181816
Pharos: P28799(Tbio)
UniProt: P28799
Structure
PDB: 
2JYT 2JYU 2JYV 2JYE

Position
17q21.31
AA seq 593 aa
MWTLVSWVALTAGLVAGTRCPDGQFCPVACCLDPGGASYSCCRPLLDKWPTTLSRHLGGP
CQVDAHCSAGHSCIFTVSGTSSCCPFPEAVACGDGHHCCPRGFHCSADGRSCFQRSGNNS
VGAIQCPDSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRCIT
PTGTHPLAKKLPAQRTNRAVALSSSVMCPDARSRCPDGSTCCELPSGKYGCCPMPNATCC
SDHLHCCPQDTVCDLIQSKCLSKENATTDLLTKLPAHTVGDVKCDMEVSCPDGYTCCRLQ
SGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSLPDPQAL
KRDVPCDNVSSCPSSDTCCQLTSGEWGCCPIPEAVCCSDHQHCCPQGYTCVAEGQCQRGS
EIVAGLEKMPARRASLSHPRDIGCDQHTSCPVGQTCCPSLGGSWACCQLPHAVCCEDRQH
CCPAGYTCNVKARSCEKEVVSAQPATFLARSPHVGVKDVECGEGHFCHDNQTCCRDNRQG
WACCPYRQGVCCADRRHCCPAGFRCAARGTKCLRREAPRWDAPLRDPALRQLL
NT seq 1782 nt   +upstreamnt  +downstreamnt
atgtggaccctggtgagctgggtggccttaacagcagggctggtggctggaacgcggtgc
ccagatggtcagttctgccctgtggcctgctgcctggaccccggaggagccagctacagc
tgctgccgtccccttctggacaaatggcccacaacactgagcaggcatctgggtggcccc
tgccaggttgatgcccactgctctgccggccactcctgcatctttaccgtctcagggact
tccagttgctgccccttcccagaggccgtggcatgcggggatggccatcactgctgccca
cggggcttccactgcagtgcagacgggcgatcctgcttccaaagatcaggtaacaactcc
gtgggtgccatccagtgccctgatagtcagttcgaatgcccggacttctccacgtgctgt
gttatggtcgatggctcctgggggtgctgccccatgccccaggcttcctgctgtgaagac
agggtgcactgctgtccgcacggtgccttctgcgacctggttcacacccgctgcatcaca
cccacgggcacccaccccctggcaaagaagctccctgcccagaggactaacagggcagtg
gccttgtccagctcggtcatgtgtccggacgcacggtcccggtgccctgatggttctacc
tgctgtgagctgcccagtgggaagtatggctgctgcccaatgcccaacgccacctgctgc
tccgatcacctgcactgctgcccccaagacactgtgtgtgacctgatccagagtaagtgc
ctctccaaggagaacgctaccacggacctcctcactaagctgcctgcgcacacagtgggg
gatgtgaaatgtgacatggaggtgagctgcccagatggctatacctgctgccgtctacag
tcgggggcctggggctgctgcccttttacccaggctgtgtgctgtgaggaccacatacac
tgctgtcccgcggggtttacgtgtgacacgcagaagggtacctgtgaacaggggccccac
caggtgccctggatggagaaggccccagctcacctcagcctgccagacccacaagccttg
aagagagatgtcccctgtgataatgtcagcagctgtccctcctccgatacctgctgccaa
ctcacgtctggggagtggggctgctgtccaatcccagaggctgtctgctgctcggaccac
cagcactgctgcccccagggctacacgtgtgtagctgaggggcagtgtcagcgaggaagc
gagatcgtggctggactggagaagatgcctgcccgccgggcttccttatcccaccccaga
gacatcggctgtgaccagcacaccagctgcccggtggggcagacctgctgcccgagcctg
ggtgggagctgggcctgctgccagttgccccatgctgtgtgctgcgaggatcgccagcac
tgctgcccggctggctacacctgcaacgtgaaggctcgatcctgcgagaaggaagtggtc
tctgcccagcctgccaccttcctggcccgtagccctcacgtgggtgtgaaggacgtggag
tgtggggaaggacacttctgccatgataaccagacctgctgccgagacaaccgacagggc
tgggcctgctgtccctaccgccagggcgtctgttgtgctgatcggcgccactgctgtcct
gctggcttccgctgcgcagccaggggtaccaagtgtttgcgcagggaggccccgcgctgg
gacgcccctttgagggacccagccttgagacagctgctgtga

DBGET integrated database retrieval system