KEGG   Homo sapiens (human): 28960
Entry
28960             CDS       T01001                                 

Gene name
DCPS, ARS, DCS1, HINT-5, HINT5, HSL1, HSPC015
Definition
(RefSeq) decapping enzyme, scavenger
  KO
K12584  m7GpppX diphosphatase [EC:3.6.1.59]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03018  RNA degradation
Disease
H01878  Al-Raqad syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    28960 (DCPS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    28960 (DCPS)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.59  5'-(N7-methyl 5'-triphosphoguanosine)-[mRNA] diphosphatase
     28960 (DCPS)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA degradation factors
   5'-3' decay
    Other 5'-3' decay factors
     28960 (DCPS)
   3'-5' decay
    Other 3'-5' decay factors
     28960 (DCPS)
SSDB
Motif
Pfam: DcpS_C DcpS
Other DBs
NCBI-GeneID: 28960
NCBI-ProteinID: NP_054745
OMIM: 610534
HGNC: 29812
Ensembl: ENSG00000110063
Vega: OTTHUMG00000165829
Pharos: Q96C86(Tbio)
UniProt: Q96C86 A0A384MTI8
Structure
PDB: 

Position
11q24.2
AA seq 337 aa
MADAAPQLGKRKRELDVEEAHAASTEEKEAGVGNGTCAPVRLPFSGFRLQKVLRESARDK
IIFLHGKVNEASGDGDGEDAVVILEKTPFQVEQVAQLLTGSPELQLQFSNDIYSTYHLFP
PRQLNDVKTTVVYPATEKHLQKYLRQDLRLIRETGDDYRNITLPHLESQSLSIQWVYNIL
DKKAEADRIVFENPDPSDGFVLIPDLKWNQQQLDDLYLIAICHRRGIRSLRDLTPEHLPL
LRNILHQGQEAILQRYRMKGDHLRVYLHYLPSYYHLHVHFTALGFEAPGSGVERAHLLAE
VIENLECDPRHYQQRTLTFALRADDPLLKLLQEAQQS
NT seq 1014 nt   +upstreamnt  +downstreamnt
atggcggacgcagctcctcaactaggcaagaggaagcgcgaattggacgtggaggaggcc
cacgccgccagcacagaggaaaaggaggcaggagttggaaatggtacctgtgctcctgtc
cgcttaccgttctccggcttcagactgcagaaggtgctgagggagtctgcgcgggacaaa
atcattttcctacacgggaaggtgaatgaggcctctggggatggggatggagaggatgcc
gttgtgatcctggagaagacgccatttcaggtggaacaggtggctcagctcctgacgggc
agccctgagctccagttgcagttctccaatgatatctacagcacctatcacttgttccct
ccaagacaactgaatgatgtaaagacgaccgtggtttaccctgccacagagaaacacctg
cagaagtacctgcgccaggacctccgcctgatccgagagacgggagatgactacaggaat
attactttaccccacctggagtcccagagcctcagcatccagtgggtgtataacattctc
gacaagaaggctgaagcggaccggattgttttcgagaacccagatccctctgatggtttt
gtcctcatccctgacctcaagtggaaccaacagcagctcgatgacttgtacttgatcgcc
atctgccatcgccggggcatcagatccctacgcgaccttactccggagcacttgccgctg
ctcaggaacatcctccaccaggggcaggaggccatcctgcagcgctaccggatgaaggga
gaccatctgcgagtatacctgcactacctgccctcctactaccacctgcatgtgcacttc
accgccctgggcttcgaggcccccggctcaggcgtggagcgggcccacctgctggctgag
gtgatcgagaacttggagtgtgaccctaggcactaccagcagcgcacgctcaccttcgcc
ctcagggctgacgaccccctgctcaagctcttgcaggaggctcagcaaagctga

DBGET integrated database retrieval system