KEGG   Homo sapiens (human): 28964Help
Entry
28964             CDS       T01001                                 

Gene name
GIT1
Definition
(RefSeq) GIT ArfGAP 1
  KO
K05737  G protein-coupled receptor kinase interactor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04810  Regulation of actin cytoskeleton
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    28964 (GIT1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    28964 (GIT1)
 09160 Human Diseases
  09167 Infectious diseases
   05120 Epithelial cell signaling in Helicobacter pylori infection
    28964 (GIT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    28964 (GIT1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    28964 (GIT1)
 Endosome - Golgi transport
   Arf GTPase associated proteins
    28964 (GIT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GIT1_C GIT_CC GIT_SHD ArfGap Ank_2 Ank_4 Ank_5 Ank Shugoshin_N ZapB YabB WDCP TTRAP
Motif
Other DBs
NCBI-GeneID: 28964
NCBI-ProteinID: NP_054749
OMIM: 608434
HGNC: 4272
Ensembl: ENSG00000108262
Vega: OTTHUMG00000132730
Pharos: Q9Y2X7(Tbio)
UniProt: Q9Y2X7
Position
17q11.2
AA seq 761 aa AA seqDB search
MSRKGPRAEVCADCSAPDPGWASISRGVLVCDECCSVHRSLGRHISIVKHLRHSAWPPTL
LQMVHTLASNGANSIWEHSLLDPAQVQSGRRKANPQDKVHPIKSEFIRAKYQMLAFVHKL
PCRDDDGVTAKDLSKQLHSSVRTGNLETCLRLLSLGAQANFFHPEKGTTPLHVAAKAGQT
LQAELLVVYGADPGSPDVNGRTPIDYARQAGHHELAERLVECQYELTDRLAFYLCGRKPD
HKNGHYIIPQMADSLDLSELAKAAKKKLQALSNRLFEELAMDVYDEVDRRENDAVWLATQ
NHSTLVTERSAVPFLPVNPEYSATRNQGRQKLARFNAREFATLIIDILSEAKRRQQGKSL
SSPTDNLELSLRSQSDLDDQHDYDSVASDEDTDQEPLRSTGATRSNRARSMDSSDLSDGA
VTLQEYLELKKALATSEAKVQQLMKVNSSLSDELRRLQREIHKLQAENLQLRQPPGPVPT
PPLPSERAEHTPMAPGGSTHRRDRQAFSMYEPGSALKPFGGPPGDELTTRLQPFHSTELE
DDAIYSVHVPAGLYRIRKGVSASAVPFTPSSPLLSCSQEGSRHTSKLSRHGSGADSDYEN
TQSGDPLLGLEGKRFLELGKEEDFHPELESLDGDLDPGLPSTEDVILKTEQVTKNIQELL
RAAQEFKHDSFVPCSEKIHLAVTEMASLFPKRPALEPVRSSLRLLNASAYRLQSECRKTV
PPEPGAPVDFQLLTQQVIQCAYDIAKAAKQLVTITTREKKQ
NT seq 2286 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgaaaggggccgcgagcggaggtgtgtgcggactgcagcgccccggaccctggc
tgggcatccatcagcaggggtgtgctggtgtgtgacgagtgctgcagcgtgcaccggagc
ctgggacgccacatctccattgtcaagcaccttcgccacagcgcctggcctcccacgctg
ctgcagatggtgcacacgcttgccagcaacggggccaactccatctgggagcactccctg
ctggaccccgcacaagtgcagagcggccggcgtaaagccaacccccaagacaaagtccac
cccatcaagtcagagttcatcagggccaagtaccagatgctggcatttgtgcacaagctt
ccctgccgggacgatgatggagtcaccgccaaagacctcagcaagcaactacactcgagc
gtgcggacaggcaacctggagacatgtctgcgcctgctctccctgggtgcccaggccaac
ttcttccacccagagaagggcaccacacctctgcacgtggctgccaaggcaggacagaca
ctgcaggccgagctgcttgtagtgtatggggctgaccctggctcccctgatgttaatggc
cgcacacccattgactatgccaggcaggcggggcaccatgagctggcggaaaggctggtt
gagtgccaatatgagctcactgaccggctggccttctacctctgtggacgcaagccggat
cacaagaatgggcattacatcatcccacagatggctgacagccttgacttatccgaattg
gccaaagctgctaagaagaagctgcaggcgctcagcaaccggctttttgaggaactcgcc
atggacgtgtatgacgaggtggatcgaagagaaaatgatgcagtgtggctggctacccaa
aaccacagcactctggtgacagagcgcagtgccgtgcccttcctgcctgttaacccggaa
tactcagccacgcggaatcaggggcgacaaaagctggcccgctttaatgcccgagagttt
gccaccttgatcatcgacattctcagtgaggccaagcggagacagcagggcaagagcctg
agcagccccacagacaacctcgagctgtctctgcggagccagagtgacctcgacgaccaa
cacgactacgacagcgtggcctctgacgaggacacagaccaggagcccctgcgcagcacc
ggcgccactcggagcaaccgggcccggagcatggactcctcggacttgtctgacggggct
gtgacgctgcaggagtacctggagctgaagaaggccctggctacatcggaggcaaaggtg
cagcagctcatgaaggtcaacagtagcctgagcgacgagctccggaggctgcagcgagag
atccacaagctgcaggcggagaacctgcagctccggcagcctccagggccggtgcccaca
cctccactccccagtgaacgggcggaacacacacccatggcgccaggcgggagcacacac
cgcagggatcgccaggccttttccatgtatgaacctggctctgccctgaagccctttggg
ggcccccctggggacgagctcactacgcggctgcagcctttccacagcactgagctagag
gacgacgccatctattcagtgcacgtccctgctggcctttaccggatccggaaaggggtg
tctgcctcagctgtgcccttcactccctcctccccgctgctgtcctgctcccaggaggga
agccgccacacgagcaagctttcccgccacggcagtggagccgacagtgactatgagaac
acgcaaagtggggacccactgctggggctggaagggaagaggtttctagagctgggcaaa
gaggaagacttccacccagagctggaaagcctggatggagacctagatcctgggcttccc
agcacagaggatgtcatcttgaagacagagcaggtcaccaagaacattcaggaactgttg
cgggcagcccaggagttcaagcatgacagcttcgtgccctgctcagagaagatccatttg
gctgtgaccgagatggcctccctcttcccaaagaggccagccctggagccagtgcggagc
tcactgcggctgctcaacgccagcgcctaccggctgcagagtgagtgccggaagacagtg
cccccagagcccggcgccccagtggacttccagctgctgactcagcaggtgatccagtgc
gcctatgacatcgccaaggctgccaagcagctggtcaccatcaccacccgagagaagaag
cagtga

DBGET integrated database retrieval system