KEGG   Homo sapiens (human): 28964Help
Entry
28964             CDS       T01001                                 

Gene name
GIT1
Definition
(RefSeq) GIT ArfGAP 1
  KO
K05737  G protein-coupled receptor kinase interactor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04810  Regulation of actin cytoskeleton
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    28964 (GIT1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    28964 (GIT1)
 09160 Human Diseases
  09171 Infectious diseases: Bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    28964 (GIT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    28964 (GIT1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    28964 (GIT1)
 Endosome - Golgi transport
   Arf GTPase associated proteins
    28964 (GIT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GIT1_C GIT_CC ArfGap GIT_SHD Ank_2 Ank_4 Ank_5 Ank Shugoshin_N ZapB TTRAP YabA WDCP
Motif
Other DBs
NCBI-GeneID: 28964
NCBI-ProteinID: NP_054749
OMIM: 608434
HGNC: 4272
Ensembl: ENSG00000108262
Vega: OTTHUMG00000132730
Pharos: Q9Y2X7(Tbio)
UniProt: Q9Y2X7
Position
17q11.2
AA seq 761 aa AA seqDB search
MSRKGPRAEVCADCSAPDPGWASISRGVLVCDECCSVHRSLGRHISIVKHLRHSAWPPTL
LQMVHTLASNGANSIWEHSLLDPAQVQSGRRKANPQDKVHPIKSEFIRAKYQMLAFVHKL
PCRDDDGVTAKDLSKQLHSSVRTGNLETCLRLLSLGAQANFFHPEKGTTPLHVAAKAGQT
LQAELLVVYGADPGSPDVNGRTPIDYARQAGHHELAERLVECQYELTDRLAFYLCGRKPD
HKNGHYIIPQMADSLDLSELAKAAKKKLQALSNRLFEELAMDVYDEVDRRENDAVWLATQ
NHSTLVTERSAVPFLPVNPEYSATRNQGRQKLARFNAREFATLIIDILSEAKRRQQGKSL
SSPTDNLELSLRSQSDLDDQHDYDSVASDEDTDQEPLRSTGATRSNRARSMDSSDLSDGA
VTLQEYLELKKALATSEAKVQQLMKVNSSLSDELRRLQREIHKLQAENLQLRQPPGPVPT
PPLPSERAEHTPMAPGGSTHRRDRQAFSMYEPGSALKPFGGPPGDELTTRLQPFHSTELE
DDAIYSVHVPAGLYRIRKGVSASAVPFTPSSPLLSCSQEGSRHTSKLSRHGSGADSDYEN
TQSGDPLLGLEGKRFLELGKEEDFHPELESLDGDLDPGLPSTEDVILKTEQVTKNIQELL
RAAQEFKHDSFVPCSEKIHLAVTEMASLFPKRPALEPVRSSLRLLNASAYRLQSECRKTV
PPEPGAPVDFQLLTQQVIQCAYDIAKAAKQLVTITTREKKQ
NT seq 2286 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgaaaggggccgcgagcggaggtgtgtgcggactgcagcgccccggaccctggc
tgggcatccatcagcaggggtgtgctggtgtgtgacgagtgctgcagcgtgcaccggagc
ctgggacgccacatctccattgtcaagcaccttcgccacagcgcctggcctcccacgctg
ctgcagatggtgcacacgcttgccagcaacggggccaactccatctgggagcactccctg
ctggaccccgcacaagtgcagagcggccggcgtaaagccaacccccaagacaaagtccac
cccatcaagtcagagttcatcagggccaagtaccagatgctggcatttgtgcacaagctt
ccctgccgggacgatgatggagtcaccgccaaagacctcagcaagcaactacactcgagc
gtgcggacaggcaacctggagacatgtctgcgcctgctctccctgggtgcccaggccaac
ttcttccacccagagaagggcaccacacctctgcacgtggctgccaaggcaggacagaca
ctgcaggccgagctgcttgtagtgtatggggctgaccctggctcccctgatgttaatggc
cgcacacccattgactatgccaggcaggcggggcaccatgagctggcggaaaggctggtt
gagtgccaatatgagctcactgaccggctggccttctacctctgtggacgcaagccggat
cacaagaatgggcattacatcatcccacagatggctgacagccttgacttatccgaattg
gccaaagctgctaagaagaagctgcaggcgctcagcaaccggctttttgaggaactcgcc
atggacgtgtatgacgaggtggatcgaagagaaaatgatgcagtgtggctggctacccaa
aaccacagcactctggtgacagagcgcagtgccgtgcccttcctgcctgttaacccggaa
tactcagccacgcggaatcaggggcgacaaaagctggcccgctttaatgcccgagagttt
gccaccttgatcatcgacattctcagtgaggccaagcggagacagcagggcaagagcctg
agcagccccacagacaacctcgagctgtctctgcggagccagagtgacctcgacgaccaa
cacgactacgacagcgtggcctctgacgaggacacagaccaggagcccctgcgcagcacc
ggcgccactcggagcaaccgggcccggagcatggactcctcggacttgtctgacggggct
gtgacgctgcaggagtacctggagctgaagaaggccctggctacatcggaggcaaaggtg
cagcagctcatgaaggtcaacagtagcctgagcgacgagctccggaggctgcagcgagag
atccacaagctgcaggcggagaacctgcagctccggcagcctccagggccggtgcccaca
cctccactccccagtgaacgggcggaacacacacccatggcgccaggcgggagcacacac
cgcagggatcgccaggccttttccatgtatgaacctggctctgccctgaagccctttggg
ggcccccctggggacgagctcactacgcggctgcagcctttccacagcactgagctagag
gacgacgccatctattcagtgcacgtccctgctggcctttaccggatccggaaaggggtg
tctgcctcagctgtgcccttcactccctcctccccgctgctgtcctgctcccaggaggga
agccgccacacgagcaagctttcccgccacggcagtggagccgacagtgactatgagaac
acgcaaagtggggacccactgctggggctggaagggaagaggtttctagagctgggcaaa
gaggaagacttccacccagagctggaaagcctggatggagacctagatcctgggcttccc
agcacagaggatgtcatcttgaagacagagcaggtcaccaagaacattcaggaactgttg
cgggcagcccaggagttcaagcatgacagcttcgtgccctgctcagagaagatccatttg
gctgtgaccgagatggcctccctcttcccaaagaggccagccctggagccagtgcggagc
tcactgcggctgctcaacgccagcgcctaccggctgcagagtgagtgccggaagacagtg
cccccagagcccggcgccccagtggacttccagctgctgactcagcaggtgatccagtgc
gcctatgacatcgccaaggctgccaagcagctggtcaccatcaccacccgagagaagaag
cagtga

DBGET integrated database retrieval system