KEGG   Homo sapiens (human): 2897Help
Entry
2897              CDS       T01001                                 

Gene name
GRIK1, EAA3, EEA3, GLR5, GLUR5, GluK1, gluR-5
Definition
(RefSeq) glutamate ionotropic receptor kainate type subunit 1
  KO
K05201  glutamate receptor, ionotropic kainate 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04724  Glutamatergic synapse
Drug target
Riluzole: D00775
Tezampanel: D06656
Topiramate: D00537
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2897 (GRIK1)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    2897 (GRIK1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    2897 (GRIK1)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   2897 (GRIK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 Peripla_BP_6
Motif
Other DBs
NCBI-GeneID: 2897
NCBI-ProteinID: NP_000821
OMIM: 138245
HGNC: 4579
Ensembl: ENSG00000171189
Vega: OTTHUMG00000078879
Pharos: P39086(Tclin)
UniProt: P39086
Structure
PDB: 

Position
21q21.3
AA seq 918 aa AA seqDB search
MEHGTLLAQPGLWTRDTSWALLYFLCYILPQTAPQVLRIGGIFETVENEPVNVEELAFKF
AVTSINRNRTLMPNTTLTYDIQRINLFDSFEASRRACDQLALGVAALFGPSHSSSVSAVQ
SICNALEVPHIQTRWKHPSVDNKDLFYINLYPDYAAISRAILDLVLYYNWKTVTVVYEDS
TGLIRLQELIKAPSRYNIKIKIRQLPSGNKDAKPLLKEMKKGKEFYVIFDCSHETAAEIL
KQILFMGMMTEYYHYFFTTLDLFALDLELYRYSGVNMTGFRLLNIDNPHVSSIIEKWSME
RLQAPPRPETGLLDGMMTTEAALMYDAVYMVAIASHRASQLTVSSLQCHRHKPWRLGPRF
MNLIKEARWDGLTGHITFNKTNGLRKDFDLDIISLKEEGTEKAAGEVSKHLYKVWKKIGI
WNSNSGLNMTDSNKDKSSNITDSLANRTLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCL
DLLKELSNILGFIYDVKLVPDGKYGAQNDKGEWNGMVKELIDHRADLAVAPLTITYVREK
VIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFT
PYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTL
IIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKM
WAFMSSRQQTALVRNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYG
VGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPEEDNKEASALGVENIGGIFI
VLAAGLVLSVFVAIGEFIYKSRKNNDIEQAFCFFYGLQCKQTHPTNSTSGTTLSTDLECG
KLIREERGIRKQSSVHTV
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atggagcacggcacactcctcgcccagcccgggctctggaccagggacaccagctgggca
ctcctctatttcctctgctatatcctccctcagaccgccccgcaagtactcaggatcgga
gggatttttgaaacagtggaaaatgagcctgttaatgttgaagaattagctttcaagttt
gcagtcaccagcattaacagaaaccgaaccctgatgcctaacaccacattaacctatgac
atccagagaattaacctttttgatagttttgaagcctcgcggagagcatgtgaccagctg
gctcttggtgtggctgctctctttggcccttcccatagctcctccgtcagtgctgtgcag
tctatttgcaatgctctcgaagttccacacatacagacccgctggaaacacccctcggtg
gacaacaaagatttgttttacatcaacctttacccagattatgcagctatcagcagggcg
atcctggatctggtcctctattacaactggaaaacagtgacagtggtgtatgaagacagc
acaggtctaattcgtctacaagagctcatcaaagctccctccagatataatattaaaatc
aaaatccgccagctgccctctgggaataaagatgccaagcctttactcaaggagatgaag
aaaggcaaggagttctatgtgatatttgattgttcacatgaaacagccgctgaaatcctt
aagcagattctgttcatgggcatgatgaccgagtactatcactactttttcacaaccctg
gacttatttgctttggatctggaactctataggtacagtggcgtaaacatgaccgggttt
cggctgcttaacattgacaaccctcacgtgtcatccatcattgagaagtggtccatggag
agactgcaggccccacccaggcccgagactggccttttggatggcatgatgacaactgaa
gcggctctgatgtacgatgctgtgtacatggtggccattgcctcgcaccgggcatcccag
ctgaccgtcagctccctgcagtgccatagacataagccatggcgcctcggacccagattt
atgaacctgatcaaagaggcccggtgggatggcttgactgggcatatcacctttaataaa
accaatggcttgaggaaggattttgatctggacattattagtctcaaagaggaaggaact
gaaaaggctgctggcgaagtgtctaaacacttgtataaagtgtggaagaagattgggatt
tggaattccaacagtgggcttaacatgacggacagcaacaaagacaagtccagcaatatc
actgattcattggccaacagaacactcattgtcaccaccattctggaagaaccctatgtt
atgtacaggaaatctgataagcctctatatggaaatgacagatttgaaggatattgccta
gacctgttgaaagaattgtcaaacatcctgggtttcatttatgatgttaaactagttccc
gatggcaaatatggggcccagaatgacaaaggggagtggaacgggatggttaaagaactc
atagatcacagggctgacctggcagtggctcctcttaccatcacctacgtgcgggagaaa
gtcattgacttctccaaacccttcatgaccctaggcatcagcattctctaccggaagccc
aatggtaccaatccaggcgttttctccttcctcaaccccctgtctccagatatttggatg
tatgtgctcttagcctgcttgggagtcagctgtgtactctttgtgattgcaaggtttaca
ccctacgagtggtataacccccacccatgcaaccctgactcagacgtggtggaaaacaat
tttactttactaaatagtttctggtttggagttggagctctcatgcagcaaggatcagag
ctgatgcccaaagctctatcgaccagaatagttggagggatatggtggtttttcacccta
atcatcatttcatcctacacggccaatctggctgccttcttgacagtagagagaatggaa
tcccccatagattcggcagatgatctggcaaagcaaaccaagatagaatatggggcggtt
agagatggatcaacaatgaccttcttcaagaaatcaaaaatctccacctatgagaagatg
tgggctttcatgagcagcaggcagcagaccgccctggtaagaaacagtgatgaggggatc
cagagagtgctcaccacagactacgcgctgctgatggagtccaccagcattgagtatgtg
acgcagagaaactgcaacctcactcagatcgggggcctcattgactccaaaggttacgga
gtgggaacacctattggttctccttaccgggataaaattactattgctattcttcaactc
caagaagaagggaagctgcatatgatgaaagagaagtggtggcgtgggaatggctgcccc
gaggaagacaacaaagaagccagtgccctgggagtggaaaatattggaggcatcttcatt
gttctggctgccggactggtcctttctgtatttgtagctattggagaattcatatacaaa
tcacggaagaataatgatattgaacaggctttttgtttcttttatggactgcaatgtaag
caaacccatccaaccaactccacttctggaactactttatctacggatttagaatgtggt
aaattaattcgagaggagagagggattcgaaaacagtcctcagttcatactgtgtaa

DBGET integrated database retrieval system