KEGG   Homo sapiens (human): 28976Help
Entry
28976             CDS       T01001                                 

Gene name
ACAD9, MC1DN20, NPD002
Definition
(RefSeq) acyl-CoA dehydrogenase family member 9
  KO
K15980  acyl-CoA dehydrogenase family member 9 [EC:1.3.99.-]
Organism
hsa  Homo sapiens (human)
Disease
H00473  Mitochondrial complex I deficiency
H00525  Disorders of mitochondrial fatty-acid oxidation
H02085  Acyl-CoA dehydrogenase 9 deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    28976 (ACAD9)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.99  With unknown physiological acceptors
    1.3.99.-  
     28976 (ACAD9)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-I assembly factors
    28976 (ACAD9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_M Acyl-CoA_dh_N Acyl-CoA_dh_2
Motif
Other DBs
NCBI-GeneID: 28976
NCBI-ProteinID: NP_054768
OMIM: 611103
HGNC: 21497
Ensembl: ENSG00000177646
Vega: OTTHUMG00000159942
Pharos: Q9H845(Tbio)
UniProt: Q9H845
Position
3q21.3
AA seq 621 aa AA seqDB search
MSGCGLFLRTTAAARACRGLVVSTANRRLLRTSPPVRAFAKELFLGKIKKKEVFPFPEVS
QDELNEINQFLGPVEKFFTEEVDSRKIDQEGKIPDETLEKLKSLGLFGLQVPEEYGGLGF
SNTMYSRLGEIISMDGSITVTLAAHQAIGLKGIILAGTEEQKAKYLPKLASGEHIAAFCL
TEPASGSDAASIRSRATLSEDKKHYILNGSKVWITNGGLANIFTVFAKTEVVDSDGSVKD
KITAFIVERDFGGVTNGKPEDKLGIRGSNTCEVHFENTKIPVENILGEVGDGFKVAMNIL
NSGRFSMGSVVAGLLKRLIEMTAEYACTRKQFNKRLSEFGLIQEKFALMAQKAYVMESMT
YLTAGMLDQPGFPDCSIEAAMVKVFSSEAAWQCVSEALQILGGLGYTRDYPYERILRDTR
ILLIFEGTNEILRMYIALTGLQHAGRILTTRIHELKQAKVSTVMDTVGRRLRDSLGRTVD
LGLTGNHGVVHPSLADSANKFEENTYCFGRTVETLLLRFGKTIMEEQLVLKRVANILINL
YGMTAVLSRASRSIRIGLRNHDHEVLLANTFCVEAYLQNLFSLSQLDKYAPENLDEQIKK
VSQQILEKRAYICAHPLDRTC
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgagcggctgcgggctcttcctgcgcaccacggctgcggctcgtgcctgccggggtctg
gtggtctctaccgcgaaccggcggctactgcgcaccagcccgcctgtacgagctttcgcc
aaagagcttttcctaggcaaaatcaagaagaaagaagttttcccatttccagaagttagc
caagatgaacttaatgaaatcaatcagttcttgggacccgtggaaaaattcttcactgaa
gaggtggactcccgaaaaattgaccaggaagggaaaatcccagatgaaactttggagaaa
ttgaagagcctagggctttttgggctgcaagtcccagaagaatatggtggcctgggcttc
tccaacaccatgtactcaagactaggggagatcatcagcatggatgggtccatcactgtg
accctggcagcgcaccaggctattggcctcaaggggatcatcttggctggcactgaggag
cagaaagccaaatacttgcctaaactggcgtccggggagcacattgcagccttctgcctc
acggagccagccagtgggagcgatgcagcctcaatccggagcagagccacactaagtgaa
gacaagaagcactacatcctcaatggctccaaggtctggattactaatggaggactggcc
aatatttttactgtgtttgcaaagactgaggtcgttgattctgatggatcagtgaaagac
aaaatcacagcattcatagtagaaagagactttggtggagtcactaatgggaaacccgaa
gataaattaggcattcggggctccaacacttgtgaagtccattttgaaaacaccaagata
cctgtggaaaacatccttggagaggtcggagatgggtttaaggtggccatgaacatcctc
aacagcggccggttcagcatgggcagcgtcgtggctgggctgctcaagagattgattgaa
atgactgctgagtacgcctgcacaaggaaacagtttaacaagaggctcagtgaatttgga
ttgattcaggagaaatttgcactgatggctcagaaggcttacgtcatggagagtatgacc
tacctcacagcagggatgctggaccaacctggctttcccgactgctccatcgaggcagcc
atggtgaaggtgttcagctccgaggccgcctggcagtgtgtgagtgaggcgctgcagatc
ctcgggggcttgggctacacaagggactatccgtacgagcgcatactgcgtgacacccgc
atcctcctcatcttcgagggaaccaatgagattctccggatgtacatcgccctgacgggt
ctgcagcatgccggccgcatcctgactaccaggatccatgagcttaaacaggccaaagtg
agcacagtcatggataccgttggccggaggcttcgggactccctgggccgaactgtggac
ctggggctgacaggcaaccatggagttgtgcaccccagtcttgcggacagtgccaacaag
tttgaggagaacacctactgcttcggccggaccgtggagacactgctgctccgctttggc
aagaccatcatggaggagcagctggtactgaagcgggtggccaacatcctcatcaacctg
tatggcatgacggccgtgctgtcgcgggccagccgctccatccgcattgggctccgcaac
cacgaccacgaggttctcttggccaacaccttctgcgtggaagcttacttgcagaatctc
ttcagcctctctcagctggacaagtatgctccagaaaacctagatgagcagattaagaaa
gtgtcccagcagatccttgagaagcgagcctatatctgtgcccaccctctggacaggaca
tgctga

DBGET integrated database retrieval system