KEGG   Homo sapiens (human): 28988Help
Entry
28988             CDS       T01001                                 

Gene name
DBNL, ABP1, HIP-55, HIP55, SH3P7
Definition
(RefSeq) drebrin like
  KO
K20520  drebrin-like protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    28988 (DBNL)
Membrane trafficking [BR:hsa04131]
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    28988 (DBNL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cofilin_ADF SH3_9 SH3_1 SH3_2
Motif
Other DBs
NCBI-GeneID: 28988
NCBI-ProteinID: NP_001014436
OMIM: 610106
HGNC: 2696
Ensembl: ENSG00000136279
Vega: OTTHUMG00000155350
Pharos: Q9UJU6(Tbio)
UniProt: Q9UJU6
Structure
PDB: 

Position
7p13
AA seq 430 aa AA seqDB search
MAANLSRNGPALQEAYVRVVTEKSPTDWALFTYEGNSNDIRVAGTGEGGLEEMVEELNSG
KVMYAFCRVKDPNSGLPKFVLINWTGEGVNDVRKGACASHVSTMASFLKGAHVTINARAE
EDVEPECIMEKVAKASGANYSFHKESGRFQDVGPQAPVGSVYQKTNAVSEIKRVGKDSFW
AKAEKEEENRRLEEKRRAEEAQRQLEQERRERELREAARREQRYQEQGGEASPQRTWEQQ
QEVVSRNRNEQESAVHPREIFKQKERAMSTTSISSPQPGKLRSPFLQKQLTQPETHFGRE
PAAAISRPRADLPAEEPAPSTPPCLVQAEEEAVYEEPPEQETFYEQPPLVQQQGAGSEHI
DHHIQGQGLSGQGLCARALYDYQAADDTEISFDPENLITGIEVIDEGWWRGYGPDGHFGM
FPANYVELIE
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgaacctgagccggaacgggccagcgctgcaagaggcctacgtgcgggtggtc
accgagaagtccccgaccgactgggctctctttacctatgaaggcaacagcaatgacatc
cgcgtggctggcacaggggagggtggcctggaggagatggtggaggagctcaacagcggg
aaggtgatgtacgccttctgcagagtgaaggaccccaactctggactgcccaaatttgtc
ctcatcaactggacaggcgagggcgtgaacgatgtgcggaagggagcctgtgccagccac
gtcagcaccatggccagcttcctgaagggggcccatgtgaccatcaacgcacgggccgag
gaggatgtggagcctgagtgcatcatggagaaggtggccaaggcttcaggtgccaactac
agctttcacaaggagagtggccgcttccaggacgtgggaccccaggccccagtgggctct
gtgtaccagaagaccaatgccgtgtctgagattaaaagggttggtaaagacagcttctgg
gccaaagcagagaaggaggaggagaaccgtcggctggaggaaaagcggcgggccgaggag
gcacagcggcagctggagcaggagcgccgggagcgtgagctgcgtgaggctgcacgccgg
gagcagcgctatcaggagcagggtggcgaggccagcccccagaggacgtgggagcagcag
caagaagtggtttcaaggaaccgaaatgagcaggagtctgccgtgcacccgagggagatt
ttcaagcagaaggagagggccatgtccaccacctccatctccagtcctcagcctggcaag
ctgaggagccccttcctgcagaagcagctcacccaaccagagacccactttggcagagag
ccagctgctgccatctcaaggcccagggcagatctccctgctgaggagccggcgcccagc
actcctccatgtctggtgcaggcagaagaggaggctgtgtatgaggaacctccagagcag
gagaccttctacgagcagcccccactggtgcagcagcaaggtgctggctctgagcacatt
gaccaccacattcagggccaggggctcagtgggcaagggctctgtgcccgtgccctgtac
gactaccaggcagccgacgacacagagatctcctttgaccccgagaacctcatcacgggc
atcgaggtgatcgacgaaggctggtggcgtggctatgggccggatggccattttggcatg
ttccctgccaactacgtggagctcattgagtga

DBGET integrated database retrieval system