KEGG   Homo sapiens (human): 28996Help
Entry
28996             CDS       T01001                                 

Gene name
HIPK2, PRO0593
Definition
(RefSeq) homeodomain interacting protein kinase 2
  KO
K08826  homeodomain interacting protein kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    28996 (HIPK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    28996 (HIPK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     28996 (HIPK2)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CMGC group
  DYRK family [OT]
   28996 (HIPK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Pkinase_fungal APH Pox_ser-thr_kin
Motif
Other DBs
NCBI-GeneID: 28996
NCBI-ProteinID: NP_073577
OMIM: 606868
HGNC: 14402
Ensembl: ENSG00000064393
Vega: OTTHUMG00000157704
Pharos: Q9H2X6(Tchem)
UniProt: Q9H2X6
Structure
PDB: 

Position
7q34
AA seq 1198 aa AA seqDB search
MAPVYEGMASHVQVFSPHTLQSSAFCSVKKLKIEPSSNWDMTGYGSHSKVYSQSKNIPLS
QPATTTVSTSLPVPNPSLPYEQTIVFPGSTGHIVVTSASSTSVTGQVLGGPHNLMRRSTV
SLLDTYQKCGLKRKSEEIENTSSVQIIEEHPPMIQNNASGATVATATTSTATSKNSGSNS
EGDYQLVQHEVLCSMTNTYEVLEFLGRGTFGQVVKCWKRGTNEIVAIKILKNHPSYARQG
QIEVSILARLSTESADDYNFVRAYECFQHKNHTCLVFEMLEQNLYDFLKQNKFSPLPLKY
IRPVLQQVATALMKLKSLGLIHADLKPENIMLVDPSRQPYRVKVIDFGSASHVSKAVCST
YLQSRYYRAPEIILGLPFCEAIDMWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLP
AEYLLSAGTKTTRFFNRDTDSPYPLWRLKTPDDHEAETGIKSKEARKYIFNCLDDMAQVN
MTTDLEGSDMLVEKADRREFIDLLKKMLTIDADKRITPIETLNHPFVTMTHLLDFPHSTH
VKSCFQNMEICKRRVNMYDTVNQSKTPFITHVAPSTSTNLTMTFNNQLTTVHNQAPSSTS
ATISLANPEVSILNYPSTLYQPSAASMAAVAQRSMPLQTGTAQICARPDPFQQALIVCPP
GFQGLQASPSKHAGYSVRMENAVPIVTQAPGAQPLQIQPGLLAQQAWPSGTQQILLPPAW
QQLTGVATHTSVQHATVIPETMAGTQQLADWRNTHAHGSHYNPIMQQPALLTGHVTLPAA
QPLNVGVAHVMRQQPTSTTSSRKSKQHQSSVRNVSTCEVSSSQAISSPQRSKRVKENTPP
RCAMVHSSPACSTSVTCGWGDVASSTTRERQRQTIVIPDTPSPTVSVITISSDTDEEEEQ
KHAPTSTVSKQRKNVISCVTVHDSPYSDSSSNTSPYSVQQRAGHNNANAFDTKGSLENHC
TGNPRTIIVPPLKTQASEVLVECDSLVPVNTSHHSSSYKSKSSSNVTSTSGHSSGSSSGA
ITYRQQRPGPHFQQQQPLNLSQAQQHITTDRTGSHRRQQAYITPTMAQAPYSFPHNSPSH
GTVHPHLAAAAAAAHLPTQPHLYTYTAPAALGSTGTVAHLVASQGSARHTVQHTAYPASI
VHQVPVSMGPRVLPSPTIHPSQYPAQFAHQTYISASPASTVYTGYPLSPAKVNQYPYI
NT seq 3597 nt NT seq  +upstreamnt  +downstreamnt
atggcccccgtgtacgaaggtatggcctcacatgtgcaagttttctcccctcacaccctt
caatcaagtgccttctgtagtgtgaagaaactgaaaatagagccgagttccaactgggac
atgactgggtacggctcccacagcaaagtgtatagccagagcaagaacatccccctgtcg
cagccagccaccacaaccgtcagcacctccttgccggtcccaaacccaagcctaccttac
gagcagaccatcgtcttcccaggaagcaccgggcacatcgtggtcacctcagcaagcagc
acttctgtcaccgggcaagtcctcggcggaccacacaacctaatgcgtcgaagcactgtg
agcctccttgatacctaccaaaaatgtggactcaagcgtaagagcgaggagatcgagaac
acaagcagcgtgcagatcatcgaggagcatccacccatgattcagaataatgcaagcggg
gccactgtcgccactgccaccacgtctactgccacctccaaaaacagcggctccaacagc
gagggcgactatcagctggtgcagcatgaggtgctgtgctccatgaccaacacctacgag
gtcttagagttcttgggccgagggacgtttgggcaagtggtcaagtgctggaaacggggc
accaatgagatcgtagccatcaagatcctgaagaaccacccatcctatgcccgacaaggt
cagattgaagtgagcatcctggcccggttgagcacggagagtgccgatgactataacttc
gtccgggcctacgaatgcttccagcacaagaaccacacgtgcttggtcttcgagatgttg
gagcagaacctctatgactttctgaagcaaaacaagtttagccccttgcccctcaaatac
attcgcccagttctccagcaggtagccacagccctgatgaaactcaaaagcctaggtctt
atccacgctgacctcaaaccagaaaacatcatgctggtggatccatctagacaaccatac
agagtcaaggtcatcgactttggttcagccagccacgtctccaaggctgtgtgctccacc
tacttgcagtccagatattacagggcccctgagatcatccttggtttaccattttgtgag
gcaattgacatgtggtccctgggctgtgttattgcagaattgttcctgggttggccgtta
tatccaggagcttcggagtatgatcagattcggtatatttcacaaacacagggtttgcct
gctgaatatttattaagcgccgggacaaagacaactaggtttttcaaccgtgacacggac
tcaccatatcctttgtggagactgaagacaccagatgaccatgaagcagagacagggatt
aagtcaaaagaagcaagaaagtacattttcaactgtttagatgatatggcccaggtgaac
atgacgacagatttggaagggagcgacatgttggtagaaaaggctgaccggcgggagttc
attgacctgttgaagaagatgctgaccattgatgctgacaagagaatcactccaatcgaa
accctgaaccatccctttgtcaccatgacacacttactcgattttccccacagcacacac
gtcaaatcatgtttccagaacatggagatctgcaagcgtcgggtgaatatgtatgacacg
gtgaaccagagcaaaacccctttcatcacgcacgtggcccccagcacgtccaccaacctg
accatgacctttaacaaccagctgaccactgtccacaaccaggctccctcctctaccagt
gccactatttccttagccaatcccgaagtctccatactaaactacccatctacactctac
cagccctcagcggcatccatggctgcagtggcccagcggagcatgcccctgcagacagga
acagcccagatttgtgcccggcctgacccgttccagcaagctctcatcgtgtgtcccccc
ggcttccaaggcttgcaggcctctccctctaagcacgctggctactcggtgcgaatggaa
aatgcagttcccatcgtcactcaagccccaggagctcagcctcttcagatccaaccaggt
ctgcttgcccagcaggcttggccaagtgggacccagcagatcctgcttcccccagcatgg
cagcaactgactggagtggccacccacacatcagtgcagcatgccaccgtgattcccgag
accatggcaggcacccagcagctggcggactggagaaatacgcatgctcacggaagccat
tataatcccatcatgcagcagcctgcactattgaccggtcatgtgacccttccagcagca
cagcccttaaatgtgggtgtggcccacgtgatgcggcagcagccaaccagcaccacctcc
tcccggaagagtaagcagcaccagtcatctgtgagaaatgtctccacctgtgaggtgtcc
tcctctcaggccatcagctccccacagcgatccaagcgtgtcaaggagaacacacctccc
cgctgtgccatggtgcacagtagcccggcctgcagcacctcggtcacctgtgggtggggc
gacgtggcctccagcaccacccgggaacggcagcggcagacaattgtcattcccgacact
cccagccccacggtcagcgtcatcaccatcagcagtgacacggacgaggaggaggaacag
aaacacgcccccaccagcactgtctccaagcaaagaaaaaacgtcatcagctgtgtcaca
gtccacgactccccctactccgactcctccagcaacaccagcccctactccgtgcagcag
cgtgctgggcacaacaatgccaatgcctttgacaccaaggggagcctggagaatcactgc
acggggaacccccgaaccatcatcgtgccacccctgaaaacccaggccagcgaagtattg
gtggagtgtgatagcctggtgccagtcaacaccagtcaccactcgtcctcctacaagtcc
aagtcctccagcaacgtgacctccaccagcggtcactcttcagggagctcatctggagcc
atcacctaccggcagcagcggccgggcccccacttccagcagcagcagccactcaatctc
agccaggctcagcagcacatcaccacggaccgcactgggagccaccgaaggcagcaggcc
tacatcactcccaccatggcccaggctccgtactccttcccgcacaacagccccagccac
ggcactgtgcacccgcatctggctgcagccgctgccgctgcccacctccccacccagccc
cacctctacacctacactgcgccggcggccctgggctccaccggcaccgtggcccacctg
gtggcctcgcaaggctctgcgcgccacaccgtgcagcacactgcctacccagccagcatc
gtccaccaggtccccgtgagcatgggcccccgggtcctgccctcgcccaccatccacccg
agtcagtatccagcccaatttgcccaccagacctacatcagcgcctcgccagcctccacc
gtctacactggatacccactgagccccgccaaggtcaaccagtacccttacatataa

DBGET integrated database retrieval system