KEGG   Homo sapiens (human): 2901Help
Entry
2901              CDS       T01001                                 

Gene name
GRIK5, EAA2, GRIK2, GluK5, KA2
Definition
(RefSeq) glutamate ionotropic receptor kainate type subunit 5
  KO
K05205  glutamate receptor, ionotropic kainate 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04724  Glutamatergic synapse
Drug target
Dasolampanel: D10107
Dasolampanel etibutil: D10108
Dasolampanel etibutil tosylate: D10109
Riluzole: D00775
Tezampanel: D06656
Topiramate: D00537
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2901 (GRIK5)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    2901 (GRIK5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    2901 (GRIK5)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   2901 (GRIK5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 Peripla_BP_6
Motif
Other DBs
NCBI-GeneID: 2901
NCBI-ProteinID: NP_002079
OMIM: 600283
HGNC: 4583
Ensembl: ENSG00000105737
Vega: OTTHUMG00000044573
Pharos: Q16478(Tclin)
UniProt: Q16478
Position
19q13.2
AA seq 980 aa AA seqDB search
MPAELLLLLIVAFASPSCQVLSSLRMAAILDDQTVCGRGERLALALAREQINGIIEVPAK
ARVEVDIFELQRDSQYETTDTMCQILPKGVVSVLGPSSSPASASTVSHICGEKEIPHIKV
GPEETPRLQYLRFASVSLYPSNEDVSLAVSRILKSFNYPSASLICAKAECLLRLEELVRG
FLISKETLSVRMLDDSRDPTPLLKEIRDDKVSTIIIDANASISHLILRKASELGMTSAFY
KYILTTMDFPILHLDGIVEDSSNILGFSMFNTSHPFYPEFVRSLNMSWRENCEASTYLGP
ALSAALMFDAVHVVVSAVRELNRSQEIGVKPLACTSANIWPHGTSLMNYLRMVEYDGLTG
RVEFNSKGQRTNYTLRILEKSRQGHREIGVWYSNRTLAMNATTLDINLSQTLANKTLVVT
TILENPYVMRRPNFQALSGNERFEGFCVDMLRELAELLRFRYRLRLVEDGLYGAPEPNGS
WTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFMTLGISILYRVHMGRKPGYFSFLD
PFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNPHPCLRARPHILENQYTLGNSLWFPV
GGFMQQGSEIMPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEVPVESADDLAD
QTNIEYGTIHAGSTMTFFQNSRYQTYQRMWNYMQSKQPSVFVKSTEEGIARVLNSRYAFL
LESTMNEYHRRLNCNLTQIGGLLDTKGYGIGMPLGSPFRDEITLAILQLQENNRLEILKR
KWWEGGRCPKEEDHRAKGLGMENIGGIFIVLICGLIIAVFVAVMEFIWSTRRSAESEEVS
VCQEMLQELRHAVSCRKTSRSRRRRRPGGPSRALLSLRAVREMRLSNGKLYSAGAGGDAG
SAHGGPQRLLDDPGPPSGARPAAPTPCTHVRVCQECRRIQALRASGAGAPPRGLGVPAEA
TSPPRPRPGPAGPRELAEHE
NT seq 2943 nt NT seq  +upstreamnt  +downstreamnt
atgccggctgagctgctgctgctgctgattgttgccttcgccagccccagctgccaggtg
ctctcatcactgcgcatggctgcaatcctggatgatcagacagtgtgtggccgcggtgag
cgtctggccttggccttggcccgggagcagatcaacgggatcatcgaggtcccagccaag
gcccgagtggaagtagacatctttgagctgcagcgggacagccagtacgagaccacggac
accatgtgtcagatcttacccaaaggggttgtgtctgtccttgggccctcctctagccca
gcatctgcctccaccgtgagccatatctgtggagagaaggagatcccccacatcaaggtg
ggtcccgaggagacaccccgccttcagtaccttcgcttcgcgtctgtcagcctgtacccc
agtaacgaggacgtcagcttggcggtctcccgaatcctcaagtccttcaactacccctcg
gccagcctcatctgcgccaaggctgagtgcctgctgcgattggaggaactggtgcgtggc
ttcctcatctccaaggagacgctgtcagtgaggatgttggacgacagccgggaccccaca
ccactgctcaaggagatccgtgatgacaaggtgtccaccatcatcatcgacgccaacgcc
tccatctcccacctcatcctccgtaaggcctcggaactgggaatgacctcagcgttttac
aagtacatcctcaccaccatggacttccccatcctgcatctggacggtattgtggaggac
tcctccaacatcctgggcttctccatgttcaacacgtcccaccccttctaccctgagttt
gtccgcagcctcaacatgtcctggagggagaactgtgaagccagcacctacctgggccct
gcgctgtcagccgccctgatgtttgacgccgtgcacgtggtggtgagcgctgtccgagag
ctgaaccgcagccaggagatcggtgtgaagcctctggcctgtacatcggccaacatttgg
ccccacgggaccagcctcatgaactacctgcgcatggtagagtatgatgggctgaccggg
cgggtcgagttcaacagcaaagggcagagaaccaactacaccctgcgcatcctagaaaag
tcccggcagggccaccgtgagattggggtgtggtactctaaccgcaccctggccatgaat
gccaccaccctggacatcaacctgtcgcagacactggccaacaagaccctggtggtcaca
accatcctggagaacccatacgtcatgcgccggcccaacttccaggccctgtcggggaac
gaacgcttcgagggcttctgcgtggacatgctgcgggagctggccgagctgctgcgcttc
cgctaccgcctgcggttggtggaggatgggctgtacggggcgcccgagcccaacggctcc
tggacgggcatggttggcgagctcatcaaccggaaggcagacctggctgtggccgccttc
accatcacagctgagcgggagaaggtcatcgacttttccaagccctttatgaccctgggg
atcagcatcctctaccgagtgcacatgggccgcaagcctggctacttctccttcctggac
cccttctcccctgctgtgtggctcttcatgcttcttgcctacctggctgtcagctgcgtc
ctgtttctggctgccaggctgagcccctatgagtggtataacccacacccatgcctgcgg
gcacgcccccacatcctggagaaccagtacacgctgggcaacagcctgtggtttcccgtg
gggggcttcatgcagcagggctcggagatcatgccccgggcgctgtccacgcgctgtgtc
agcggagtctggtgggccttcaccttgatcatcatctcctcctacacggccaacctggcc
gccttcctcaccgtgcagcgcatggaggtgcctgtggagtcggccgatgacctggcagat
cagaccaacatcgagtatggcaccatccacgccggctccaccatgaccttcttccagaat
tcacggtaccaaacgtaccagcgcatgtggaactacatgcagtcgaagcagcccagcgtg
ttcgtcaagagcacagaagagggcattgcccgcgtcctcaactcccgctacgccttcctg
ctcgagtccaccatgaacgaataccaccggcgcctcaactgcaacctcacccagatcggg
ggactcctcgacaccaagggctacggcattggcatgccgctgggctccccgttccgggat
gagatcacactggccatcctgcagcttcaggagaacaaccggctggagatcctgaagcgc
aagtggtgggaggggggccggtgccccaaggaggaggaccatcgagctaaaggtttgggc
atggagaacattggtggcatttttatcgtgctcatctgtggcctcatcattgctgtcttc
gtggcggtcatggaattcatatggtccacacggaggtcagctgagtccgaggaggtgtcg
gtgtgccaggagatgctgcaggagctgcgccacgccgtttcttgccgcaagacgtcgcgt
tcccgccggcgccgacgcccgggcggcccgagccgggccctgctgtcactgcgcgcggtc
cgcgagatgcgcctcagcaacggcaagctctactcggccggcgcgggcggggatgcgggc
agcgcgcacgggggcccgcagcgcctcctggacgacccggggccccccagcggagcccga
cccgccgcccccaccccctgcacccacgtgcgcgtctgccaggagtgccggcgcatccag
gcgctgcgggcctcgggggccggcgcgcctccgcgtggcctgggcgtccccgccgaagcc
accagcccgccccggccgcggcctggccccgccggcccccgggagctggcggagcacgag
tga

DBGET integrated database retrieval system