KEGG   Homo sapiens (human): 29028Help
Entry
29028             CDS       T01001                                 

Gene name
ATAD2, ANCCA, CT137, PRO2000
Definition
(RefSeq) ATPase family, AAA domain containing 2
  KO
K22531  ATPase family AAA domain-containing protein 2 [EC:3.6.1.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    29028 (ATAD2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-  
     29028 (ATAD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AAA Bromodomain AAA_lid_3 IstB_IS21 AAA_2 AAA_16 YL1 SDA1 AAA_22 AAA_18 RNA_helicase AAA_5 RuvB_N NACHT AAA_7
Motif
Other DBs
NCBI-GeneID: 29028
NCBI-ProteinID: NP_054828
OMIM: 611941
HGNC: 30123
Ensembl: ENSG00000156802
Vega: OTTHUMG00000165090
Pharos: Q6PL18(Tbio)
UniProt: Q6PL18 A0A024R9G7
Structure
PDB: 

Position
8q24.13
AA seq 1390 aa AA seqDB search
MVVLRSSLELHNHSAASATGSLDLSSDFLSLEHIGRRRLRSAGAAQKKPAATTAKAGDGS
SVKEVETYHRTRALRSLRKDAQNSSDSSFEKNVEITEQLANGRHFTRQLARQQADKKKEE
HREDKVIPVTRSLRARNIVQSTEHLHEDNGDVEVRRSCRIRSRYSGVNQSMLFDKLITNT
AEAVLQKMDDMKKMRRQRMRELEDLGVFNETEESNLNMYTRGKQKDIQRTDEETTDNQEG
SVESSEEGEDQEHEDDGEDEDDEDDDDDDDDDDDDDDEDDEDEEDGEEENQKRYYLRQRK
ATVYYQAPLEKPRHQRKPNIFYSGPASPARPRYRLSSAGPRSPYCKRMNRRRHAIHSSDS
TSSSSSEDEQHFERRRKRSRNRAINRCLPLNFRKDELKGIYKDRMKIGASLADVDPMQLD
SSVRFDSVGGLSNHIAALKEMVVFPLLYPEVFEKFKIQPPRGCLFYGPPGTGKTLVARAL
ANECSQGDKRVAFFMRKGADCLSKWVGESERQLRLLFDQAYQMRPSIIFFDEIDGLAPVR
SSRQDQIHSSIVSTLLALMDGLDSRGEIVVIGATNRLDSIDPALRRPGRFDREFLFSLPD
KEARKEILKIHTRDWNPKPLDTFLEELAENCVGYCGADIKSICAEAALCALRRRYPQIYT
TSEKLQLDLSSINISAKDFEVAMQKMIPASQRAVTSPGQALSTVVKPLLQNTVDKILEAL
QRVFPHAEFRTNKTLDSDISCPLLESDLAYSDDDVPSVYENGLSQKSSHKAKDNFNFLHL
NRNACYQPMSFRPRILIVGEPGFGQGSHLAPAVIHALEKFTVYTLDIPVLFGVSTTSPEE
TCAQVIREAKRTAPSIVYVPHIHVWWEIVGPTLKATFTTLLQNIPSFAPVLLLATSDKPH
SALPEEVQELFIRDYGEIFNVQLPDKEERTKFFEDLILKQAAKPPISKKKAVLQALEVLP
VAPPPEPRSLTAEEVKRLEEQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPD
YVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACA
LRDTAYAIIKEELDEDFEQLCEEIQESRKKRGCSSSKYAPSYYHVMPKQNSTLVGDKRSD
PEQNEKLKTPSTPVACSTPAQLKRKIRKKSNWYLGTIKKRRKISQAKDDSQNAIDHKIES
DTEETQDTSVDHNETGNTGESSVEENEKQQNASESKLELRNNSNTCNIENELEDSRKTTA
CTELRDKIACNGDASSSQIIHISDENEGKEMCVLRMTRARRSQVEQQQLITVEKALAILS
QPTPSLVVDHERLKNLLKTVVKKSQNYNIFQLENLYAVISQCIYRHRKDHDKTSLIQKME
QEVENFSCSR
NT seq 4173 nt NT seq  +upstreamnt  +downstreamnt
atggtggttctccgcagcagcttggagctgcacaaccactccgcggcctcggccacgggc
tccttggacctgtccagtgacttcctcagtctggagcacatcggccggaggcggctccgc
tcggccggcgcggcgcagaagaaacccgcggcgaccacagccaaagcgggcgatgggtca
tcagttaaggaagttgaaacctaccaccggacacgtgctttaagatctttgagaaaagat
gcacagaattcttcagattctagttttgagaagaatgtggaaataacggagcaacttgct
aatggcaggcattttacaaggcagttggccagacagcaggctgataaaaaaaaagaagag
cacagagaagacaaagtgattccagttactcggtcattgagggctagaaacatcgttcaa
agtacagaacacttacatgaagataatggtgatgttgaagtgcgtcgaagttgtaggatt
agaagtcgttatagtggtgtaaaccagtccatgctgtttgacaaacttataactaacact
gctgaagctgtacttcaaaaaatggatgacatgaagaagatgcgtagacagcgaatgaga
gaacttgaagacttgggagtgtttaatgaaacagaagaaagcaatcttaatatgtacaca
agaggaaaacagaaagatattcaaagaactgatgaagaaacaactgataatcaagaaggc
agtgtggagtcatctgaagagggtgaagaccaagaacatgaagatgatggtgaagatgaa
gatgatgaagatgatgatgatgatgacgatgatgatgatgatgatgatgatgaagatgat
gaagatgaagaagatggagaagaagagaatcagaagcgatattatcttagacagagaaaa
gctactgtttactatcaggctccattggaaaaacctcgtcaccagagaaagcccaacata
ttttatagtggcccagcttctcctgcaagaccaagataccgattatcttccgcaggacca
agaagtccttactgtaaacgaatgaacaggcgaaggcatgcaatccacagtagtgactcg
acttcatcttcctcctctgaagatgaacagcactttgagaggcggaggaaaaggagtcgt
aatagggctatcaataggtgcctcccactaaattttcggaaagatgaattaaaaggcatt
tataaagatcgaatgaaaattggagcaagccttgccgatgttgatccaatgcaactagat
tcttcagtacgatttgatagtgttggtggcctgtctaatcatatagcagctctaaaagag
atggtggtgtttccattactttatccagaagtctttgaaaaatttaaaattcaaccccca
agaggttgtttgttttatgggccacctggaactggaaagactctggttgccagagcactt
gccaatgagtgcagtcaaggggataaaagagtagcatttttcatgaggaaaggtgctgat
tgtctaagtaaatgggtaggagaatctgaaagacagctacgattgctgtttgatcaggcc
tatcagatgcgcccatcaattattttttttgacgaaattgatggtctggctccagtacgg
tcaagcaggcaagatcagattcacagttctattgtttccaccctgctagctcttatggat
ggattggacagcagaggggaaattgtggtcattggtgctacgaacaggctagattctata
gatcctgctttacgaaggcctggtcgctttgatagagaattcctctttagcctgcctgat
aaagaggctcgaaaagagattctaaagattcacaccagggattggaatcccaaaccactg
gacacatttttagaagagctagcagaaaactgtgttggatactgtggagcagatattaaa
tcaatatgtgctgaagctgctttatgtgctttacgacgacgctacccacagatctatacc
actagtgagaaactgcagttggatctctcttcaattaatatctcagctaaggatttcgag
gtagctatgcaaaagatgataccagcctcccaaagagctgtgacatcacctgggcaggca
ctgtccaccgttgtgaaaccactcctgcaaaacactgttgacaagattttagaagccctg
cagagagtatttccacatgcagaattcagaacaaataaaacattagactcagatatttct
tgtcctctgctagaaagtgacttggcttacagtgatgatgatgttccatcagtttatgaa
aatggactttctcagaaatcttctcataaggcaaaagacaattttaattttcttcatttg
aatagaaatgcttgttaccaacctatgtcttttcgaccaagaatattgatagtaggagaa
ccaggatttgggcaaggttctcacttggcaccagctgtcattcatgctttggaaaagttt
actgtatatacattagacattcctgttctttttggagttagtactacatcccctgaagaa
acatgtgcccaggtgattcgtgaagctaagagaacagcaccaagtatagtgtatgttcct
catatccacgtgtggtgggaaatagttggaccgacacttaaagccacatttaccacatta
ttacagaatattccttcatttgctccagttttactacttgcaacttctgacaaaccccat
tccgctttgccagaagaggtgcaagaattgtttatccgtgattatggagagatttttaat
gtccagttaccggataaagaagaacggacaaaattttttgaagatttaattctaaaacaa
gctgctaagcctcctatatcaaaaaagaaagcagttttgcaggctttggaggtactccca
gtagcaccaccacctgagccaagatcactgacagcagaagaagtgaaacgactagaagaa
caagaagaagatacatttagagaactgaggattttcttaagaaatgttacacataggctt
gctattgacaagcgattccgagtgtttactaagcctgttgaccctgatgaggttcctgat
tatgtcactgtaataaagcaaccaatggacctttcatctgtaatcagtaaaattgatcta
cacaagtatctgactgtgaaagactatttgagagatattgatctaatctgtagtaatgcc
ttagaatacaatccagatagagatcctggagatcgtcttattaggcatagagcctgtgct
ttaagagatactgcctatgccataattaaagaagaacttgatgaagactttgagcagctc
tgtgaagaaattcaggaatctagaaagaaaagaggttgtagctcctccaaatatgccccg
tcttactaccatgtgatgccaaagcaaaattccactcttgttggtgataaaagatcagac
ccagagcagaatgaaaagctaaagacaccgagtactcctgtggcttgcagcactcctgct
cagttgaagaggaaaattcgcaaaaagtcaaactggtacttaggcaccataaaaaagcga
aggaagatttcacaggcaaaggatgatagccagaatgccatagatcacaaaattgagagt
gatacagaggaaactcaagacacaagtgtagatcataatgagaccggaaacacaggagag
tcttcggtggaagaaaatgaaaaacagcaaaatgcctctgaaagcaaactggaattgaga
aataattcaaatacttgtaatatagagaatgagcttgaagactctaggaagactacagca
tgtacagaattgagagacaagattgcttgtaatggagatgcttctagctctcagataata
catatttctgatgaaaatgaaggaaaagaaatgtgtgttctgcgaatgactcgagctaga
cgttcccaggtagaacagcagcagctcatcactgttgaaaaggctttggcaattctttct
cagcctacaccctcacttgttgtggatcatgagcgattaaaaaatcttttgaagactgtt
gttaaaaaaagtcaaaactacaacatatttcagttggaaaatttgtatgcagtaatcagc
caatgtatttatcggcatcgcaaggaccatgataaaacatcacttattcagaaaatggag
caagaggtagaaaacttcagttgttccagatga

DBGET integrated database retrieval system