KEGG   Homo sapiens (human): 2905Help
Entry
2905              CDS       T01001                                 

Gene name
GRIN2C, GluN2C, NMDAR2C, NR2C
Definition
(RefSeq) glutamate ionotropic receptor NMDA type subunit 2C
  KO
K05211  glutamate receptor ionotropic, NMDA 2C
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04713  Circadian entrainment
hsa04720  Long-term potentiation
hsa04724  Glutamatergic synapse
hsa05010  Alzheimer disease
hsa05014  Amyotrophic lateral sclerosis (ALS)
hsa05030  Cocaine addiction
hsa05031  Amphetamine addiction
hsa05033  Nicotine addiction
hsa05034  Alcoholism
Drug target
Acamprosate (DG00996): D02780 D07058
Amantadine (DG00860): D00777 D07441
Apimostinel: D11299
Aptiganel hydrochloride: D02973
Budipine (DG00866): D07306 D07589
Delucemine hydrochloride: D03679
Dextromethorphan (DG01078): D00848 D03742 D03744
Dextrorphan hydrochloride: D03746
Dizocilpine maleate: D03878
Esketamine (DG01829): D07283 D10627
Felbamate: D00536
Gavestinel: D04308
Ketamine (DG00796): D00711 D08098
Latrepirdine (DG01379): D09917 D09918
Levomethadone (DG01002): D08121 D08122
Licostinel: D04728
Memantine (DG00986): D04905 D08174
Methadone (DG00999): D02102 D08195
Orphenadrine (DG01252): D08305
Orphenadrine (chloride): D02599
Orphenadrine (citrate): D00774
Perzinfotel: D05447
Phencyclidine hydrochloride: D05453
Remacemide hydrochloride: D05714
Riluzole: D00775
Selfotel: D02410
Tiletamine (DG01380): D06146 D08596
Troriluzole (DG03011): D11414
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    2905 (GRIN2C)
   04024 cAMP signaling pathway
    2905 (GRIN2C)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2905 (GRIN2C)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    2905 (GRIN2C)
   04720 Long-term potentiation
    2905 (GRIN2C)
  09159 Environmental adaptation
   04713 Circadian entrainment
    2905 (GRIN2C)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    2905 (GRIN2C)
   05014 Amyotrophic lateral sclerosis (ALS)
    2905 (GRIN2C)
  09165 Substance dependence
   05030 Cocaine addiction
    2905 (GRIN2C)
   05031 Amphetamine addiction
    2905 (GRIN2C)
   05033 Nicotine addiction
    2905 (GRIN2C)
   05034 Alcoholism
    2905 (GRIN2C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    2905 (GRIN2C)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   2905 (GRIN2C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lig_chan Lig_chan-Glu_bd SBP_bac_3 ANF_receptor NMDAR2_C
Motif
Other DBs
NCBI-GeneID: 2905
NCBI-ProteinID: NP_000826
OMIM: 138254
HGNC: 4587
Ensembl: ENSG00000161509
Vega: OTTHUMG00000044524
Pharos: Q14957(Tclin)
UniProt: Q14957 O15398
Position
17q25.1
AA seq 1233 aa AA seqDB search
MGGALGPALLLTSLFGAWAGLGPGQGEQGMTVAVVFSSSGPPQAQFRARLTPQSFLDLPL
EIQPLTVGVNTTNPSSLLTQICGLLGAAHVHGIVFEDNVDTEAVAQILDFISSQTHVPIL
SISGGSAVVLTPKEPGSAFLQLGVSLEQQLQVLFKVLEEYDWSAFAVITSLHPGHALFLE
GVRAVADASHVSWRLLDVVTLELGPGGPRARTQRLLRQLDAPVFVAYCSREEAEVLFAEA
AQAGLVGPGHVWLVPNLALGSTDAPPATFPVGLISVVTESWRLSLRQKVRDGVAILALGA
HSYWRQHGTLPAPAGDCRVHPGPVSPAREAFYRHLLNVTWEGRDFSFSPGGYLVQPTMVV
IALNRHRLWEMVGRWEHGVLYMKYPVWPRYSASLQPVVDSRHLTVATLEERPFVIVESPD
PGTGGCVPNTVPCRRQSNHTFSSGDVAPYTKLCCKGFCIDILKKLARVVKFSYDLYLVTN
GKHGKRVRGVWNGMIGEVYYKRADMAIGSLTINEERSEIVDFSVPFVETGISVMVARSNG
TVSPSAFLEPYSPAVWVMMFVMCLTVVAITVFMFEYFSPVSYNQNLTRGKKSGGPAFTIG
KSVWLLWALVFNNSVPIENPRGTTSKIMVLVWAFFAVIFLASYTANLAAFMIQEQYIDTV
SGLSDKKFQRPQDQYPPFRFGTVPNGSTERNIRSNYRDMHTHMVKFNQRSVEDALTSLKM
GKLDAFIYDAAVLNYMAGKDEGCKLVTIGSGKVFATTGYGIAMQKDSHWKRAIDLALLQF
LGDGETQKLETVWLSGICQNEKNEVMSSKLDIDNMAGVFYMLLVAMGLALLVFAWEHLVY
WKLRHSVPNSSQLDFLLAFSRGIYSCFSGVQSLASPPRQASPDLTASSAQASVLKMLQAA
RDMVTTAGVSSSLDRATRTIENWGGGRRAPPPSPCPTPRSGPSPCLPTPDPPPEPSPTGW
GPPDGGRAALVRRAPQPPGRPPTPGPPLSDVSRVSRRPAWEARWPVRTGHCGRHLSASER
PLSPARCHYSSFPRADRSGRPFLPLFPELEDLPLLGPEQLARREALLHAAWARGSRPRHA
SLPSSVAEAFARPSSLPAGCTGPACARPDGHSACRRLAQAQSMCLPIYREACQEGEQAGA
PAWQHRQHVCLHAHAHLPFCWGAVCPHLPPCASHGSWLSGAWGPLGHRGRTLGLGTGYRD
SGGLDEISRVARGTQGFPGPCTWRRISSLESEV
NT seq 3702 nt NT seq  +upstreamnt  +downstreamnt
atgggtggggccctggggccggccctgttgctcacctcgctcttcggtgcctgggcaggg
ctgggtccggggcagggcgagcagggcatgacggtggccgtggtgtttagcagctcaggg
ccgccccaggcccagttccgtgcccgcctcaccccccagagcttcctggacctacccctg
gagatccagccgctcacagttggggtcaacaccaccaaccccagcagcctcctcacccag
atctgcggcctcctgggtgctgcccacgtccacggcattgtctttgaggacaacgtggac
accgaggcggtggcccagatccttgacttcatctcctcccagacccatgtgcccatcctc
agcatcagcggaggctctgctgtggtcctcacccccaaggagccgggctccgccttcctg
cagctgggcgtgtccctggagcagcagctgcaggtgctgttcaaggtgctggaagagtac
gactggagcgccttcgccgtcatcaccagcctgcacccgggccacgcgctcttcctggag
ggcgtgcgcgccgtcgccgacgccagccacgtgagttggcggctgctggacgtggtcacg
ctggagctgggcccgggagggccgcgcgcgcgcacgcagcgcctgctgcgccagctcgac
gcgcccgtgtttgtggcctactgctcgcgcgaggaggccgaggtgctcttcgccgaggcg
gcgcaggccggtctggtggggcccggccacgtgtggctggtgcccaacctggcgctgggc
agcaccgatgcgccccccgccaccttccccgtgggcctcatcagcgtcgtcaccgagagc
tggcgcctcagcctgcgccagaaggtgcgcgacggcgtggccattctggccctgggcgcc
cacagctactggcgccagcatggaaccctgccagccccggccggggactgccgtgttcac
cctgggcccgtcagccctgcccgggaggccttctacaggcacctactgaatgtcacctgg
gagggccgagacttctccttcagccctggtgggtacctggtccagcccaccatggtggtg
atcgccctcaaccggcaccgcctctgggagatggtggggcgctgggagcatggcgtccta
tacatgaagtaccccgtgtggcctcgctacagtgcctctctgcagcctgtggtggacagt
cggcacctgacggtggccacgctggaagagcggccctttgtcatcgtggagagccctgac
cctggcacaggaggctgtgtccccaacaccgtgccctgccgcaggcagagcaaccacacc
ttcagcagcggggacgtggccccctacaccaagctctgctgtaagggattctgcatcgac
atcctcaagaagctggccagagtggtcaaattctcctacgacctgtacctggtgaccaac
ggcaagcatggcaagcgggtgcgcggcgtatggaacggcatgattggggaggtgtactac
aagcgggcagacatggccatcggctccctcaccatcaatgaggaacgctccgagatcgta
gacttctctgtaccctttgtggagacgggcatcagtgtgatggtggctcgcagcaatggc
accgtctccccctcggccttcttggagccatatagccctgcagtgtgggtgatgatgttt
gtcatgtgcctcactgtggtggccatcaccgtcttcatgttcgagtacttcagccctgtc
agctacaaccagaacctcaccagaggcaagaagtccgggggcccagctttcactatcggc
aagtccgtgtggctgctgtgggcgctggtcttcaacaactcagtgcccatcgagaacccg
cggggcaccaccagcaagatcatggttctggtctgggccttctttgctgtcatcttcctc
gccagctacacggccaacctggccgccttcatgatccaagagcaatacatcgacactgtg
tcgggcctcagtgacaagaagtttcagcggcctcaagatcagtacccacctttccgcttc
ggcacggtgcccaacggcagcacggagcggaacatccgcagtaactaccgtgacatgcac
acccacatggtcaagttcaaccagcgctcggtggaggacgcgctcaccagcctcaagatg
gggaagctggatgccttcatctatgatgctgctgtcctcaactacatggcaggcaaggac
gagggctgcaagctggtcaccattgggtctggcaaggtctttgctaccactggctacggc
atcgccatgcagaaggactcccactggaagcgggccatagacctggcgctcttgcagttc
ctgggggacggagagacacagaaactggagacagtgtggctctcagggatctgccagaat
gagaagaacgaggtgatgagcagcaagctggacatcgacaacatggcaggcgtcttctac
atgctgctggtggccatggggctggccctgctggtcttcgcctgggagcacctggtctac
tggaagctgcgccactcggtgcccaactcatcccagctggacttcctgctggctttcagc
aggggcatctacagctgcttcagcggggtgcagagcctcgccagcccaccgcggcaggcc
agcccggacctcacggccagctcggcccaggccagcgtgctcaagatgctgcaggcagcc
cgcgacatggtgaccacggcgggcgtaagcagctccctggaccgcgccactcgcaccatc
gagaattggggtggcggccgccgtgcgcccccaccgtccccctgcccgaccccgcggtct
ggccccagcccatgcctgcccacccccgacccgcccccagagccgagccccacgggctgg
ggaccgccagacgggggtcgcgcggcgcttgtgcgcagggctccgcagcccccgggccgc
cccccgacgccggggccgcccctgtccgacgtctcccgagtgtcgcgccgcccagcctgg
gaggcgcggtggccggtgcggaccgggcactgcgggaggcacctctcggcctccgagcgg
cccctgtcgcccgcgcgctgtcactacagctcctttcctcgagccgaccgatccggccgc
cccttcctcccgctcttcccggagctggaggacctgccgctgctcggtccggagcagctg
gcccggcgggaggccctgctgcacgcggcctgggcccggggctcgcgcccgcgtcacgct
tccctgcccagctccgtggccgaggccttcgctcggcccagctcgctgcccgctgggtgc
accggccccgcctgcgcccgccccgacggccactcggcctgcaggcgcttggcgcaggcg
cagtcgatgtgcttgccgatctaccgggaggcctgccaggagggcgagcaggcaggggcc
cccgcctggcagcacagacagcacgtctgcctgcacgcccacgcccacctgccattttgc
tggggggctgtctgtcctcaccttccaccctgtgccagccacggctcctggctctccggg
gcctgggggcctctggggcacaggggcaggactctggggctgggcacaggctacagagac
agtgggggactggacgagatcagcagggtagcccgtgggacgcaaggcttcccgggaccc
tgcacctggagacggatctccagtctggagtcagaagtgtga

DBGET integrated database retrieval system