KEGG   Homo sapiens (human): 2908
Entry
2908              CDS       T01001                                 

Gene name
NR3C1, GCCR, GCR, GCRST, GR, GRL
Definition
(RefSeq) nuclear receptor subfamily 3 group C member 1
  KO
K05771  glucocorticoid receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Network
nt06310  CRH-ACTH-cortisol signaling
  Element
N00924  Glucocorticoid receptor signaling pathway
N00925  Mutation-inactivated NR3C1 to glucocorticoid receptor signaling pathway
Disease
H01702  Glucocorticoid resistance syndrome
H01709  Glucocorticoid-induced osteonecrosis
Drug target
Alclometasone (DG00415): D01820<JP/US> D07116
Amcinonide: D01387<JP/US>
Beclometasone (DG00097): D00689<JP/US> D07495 D11572<US>
Betamethasone (DG00095): D00244<JP> D00972<JP> D01357<JP/US> D01402 D01637<JP/US> D02032<JP> D02286
Budesonide: D00246<JP/US>
Ciclesonide: D01703<JP/US>
Clobetasol (DG00422): D01272<JP/US> D07715
Clobetasone (DG00411): D01273<JP> D07717
Clocortolone (DG00416): D02287<US> D03541 D07719
Cloprednol: D03561
Cortisone (DG00509): D00973<JP/US> D07749
Cortivazol: D03594
Dagrocorat: D10617
Deflazacort: D03671<US>
Deprodone propionate: D01434<JP>
Descinolone acetonide: D03691
Desonide: D03696<US>
Desoximetasone: D03697<US>
Dexamethasone (DG00011): D00292<JP/US> D00975<JP/US> D01510<JP> D01615<JP> D01632<JP> D01948<JP> D02174 D02591 D02592 D07073<JP> D07796 D07797 D07798 D07799 D07800 D07801 D07802
Dichlorisone (DG02936): D07814 D07815
Diflorasone (DG00418): D01327<JP/US> D07827
Diflucortolone (DG00417): D01764<JP> D03812 D03813
Difluprednate: D01266<JP/US>
Exicorilant: D11665
Fluclorolone: D04201
Fludroxycortide: D00328<JP/US>
Flumetasone (DG00412): D01464 D04208
Flunisolide (DG01040): D00324<US> D04214
Fluocinolone acetonide: D01825<JP/US>
Fluocinonide: D00325<JP/US>
Fluocortin (DG00413): D04217 D07972
Fluocortolone (DG00295): D04218 D04219 D07973
Fluorometholone (DG00294): D01367<JP/US> D04221<US>
Flupamesone: D07975
Fluprednidene (DG00414): D07201 D07980
Fluprednisolone (DG02888): D04227 D04228
Fluticasone (DG00420): D01708<JP/US> D06315<JP/US> D07981
Formocortal: D04244
Fosdagrocorat: D10634
Halcinonide: D01308<US>
Halometasone: D07202
Halopredone (DG01376): D01743 D08036
Hydrocortisone (DG00012): D00088<JP/US> D00165<US> D00976 D00977<JP> D00978<JP/US> D01442 D01619<JP/US> D01886<JP/US> D02288<US> D04467 D06876 D09796
Loteprednol (DG01127): D01689<US> D08147
Mapracorat: D10136
Medrysone: D02289
Meprednisone: D06673
Methylprednisolone (DG00410): D00407<JP/US> D00751<JP/US> D00979<JP/US> D05000 D05001 D05002 D07203
Mifepristone: D00585<US>
Miricorilant: D11667
Mometasone (DG00419): D00690<JP/US> D03325<JP/US> D08227
Nivazol: D05194
Paramethasone (DG00508): D01229 D07464
Prednicarbate: D05601<US>
Prednisolone (DG00093): D00472<JP/US> D00980<JP/US> D00981<JP/US> D00982 D01239<JP> D01998 D02156 D03301<JP> D08412 D08413 D08414 D08415
Prednisone (DG00094): D00473<US> D08416
Prednival: D05603
Prednylidene: D07230
Proligestone: D08429
Relacorilant: D11336
Resocortol (DG01545): D05719 D08476
Rimexolone: D05729
Ticabesone propionate: D06135
Tipredane: D06161
Tixocortol (DG00096): D06171 D08610
Tralonide: D06201
Triamcinolone (DG00010): D00385<JP> D00983<JP/US> D00984 D00985 D06216
Ulobetasol (DG00421): D04409<US> D08660
Vamorolone: D11000
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2908 (NR3C1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    2908 (NR3C1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:hsa03310]
    2908 (NR3C1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    2908 (NR3C1)
Nuclear receptors [BR:hsa03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   2908 (NR3C1)
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 2908
NCBI-ProteinID: NP_000167
OMIM: 138040
HGNC: 7978
Ensembl: ENSG00000113580
Vega: OTTHUMG00000129677
Pharos: P04150(Tclin)
UniProt: P04150 F1D8N4
Structure
PDB: 

Position
5q31.3
AA seq 777 aa
MDSKESLTPGREENPSSVLAQERGDVMDFYKTLRGGATVKVSASSPSLAVASQSDSKQRR
LLVDFPKGSVSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDLK
LLEESIANLNRSTSVPENPKSSASTAVSAAPTEKEFPKTHSDVSSEQQHLKGQTGTNGGN
VKLYTTDQSTFDILQDLEFSSGSPGKETNESPWRSDLLIDENCLLSPLAGEDDSFLLEGN
SNEDCKPLILPDTKPKIKDNGDLVLSSPSNVTLPQVKTEKEDFIELCTPGVIKQEKLGTV
YCQASFPGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPIFNVIPPIPVG
SENWNRCQGSGDDNLTSLGTLNFPGRTVFSNGYSSPSMRPDVSSPPSSSSTATTGPPPKL
CLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRK
CLQAGMNLEARKTKKKIKGIQQATTGVSQETSENPGNKTIVPATLPQLTPTLVSLLEVIE
PEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSW
MFLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPCMYDQCKHMLYVSSELHRLQVSY
EEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTK
LLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK
NT seq 2334 nt   +upstreamnt  +downstreamnt
atggactccaaagaatcattaactcctggtagagaagaaaaccccagcagtgtgcttgct
caggagaggggagatgtgatggacttctataaaaccctaagaggaggagctactgtgaag
gtttctgcgtcttcaccctcactggctgtcgcttctcaatcagactccaagcagcgaaga
cttttggttgattttccaaaaggctcagtaagcaatgcgcagcagccagatctgtccaaa
gcagtttcactctcaatgggactgtatatgggagagacagaaacaaaagtgatgggaaat
gacctgggattcccacagcagggccaaatcagcctttcctcgggggaaacagacttaaag
cttttggaagaaagcattgcaaacctcaataggtcgaccagtgttccagagaaccccaag
agttcagcatccactgctgtgtctgctgcccccacagagaaggagtttccaaaaactcac
tctgatgtatcttcagaacagcaacatttgaagggccagactggcaccaacggtggcaat
gtgaaattgtataccacagaccaaagcacctttgacattttgcaggatttggagttttct
tctgggtccccaggtaaagagacgaatgagagtccttggagatcagacctgttgatagat
gaaaactgtttgctttctcctctggcgggagaagacgattcattccttttggaaggaaac
tcgaatgaggactgcaagcctctcattttaccggacactaaacccaaaattaaggataat
ggagatctggttttgtcaagccccagtaatgtaacactgccccaagtgaaaacagaaaaa
gaagatttcatcgaactctgcacccctggggtaattaagcaagagaaactgggcacagtt
tactgtcaggcaagctttcctggagcaaatataattggtaataaaatgtctgccatttct
gttcatggtgtgagtacctctggaggacagatgtaccactatgacatgaatacagcatcc
ctttctcaacagcaggatcagaagcctatttttaatgtcattccaccaattcccgttggt
tccgaaaattggaataggtgccaaggatctggagatgacaacttgacttctctggggact
ctgaacttccctggtcgaacagttttttctaatggctattcaagccccagcatgagacca
gatgtaagctctcctccatccagctcctcaacagcaacaacaggaccacctcccaaactc
tgcctggtgtgctctgatgaagcttcaggatgtcattatggagtcttaacttgtggaagc
tgtaaagttttcttcaaaagagcagtggaaggacagcacaattacctatgtgctggaagg
aatgattgcatcatcgataaaattcgaagaaaaaactgcccagcatgccgctatcgaaaa
tgtcttcaggctggaatgaacctggaagctcgaaaaacaaagaaaaaaataaaaggaatt
cagcaggccactacaggagtctcacaagaaacctctgaaaatcctggtaacaaaacaata
gttcctgcaacgttaccacaactcacccctaccctggtgtcactgttggaggttattgaa
cctgaagtgttatatgcaggatatgatagctctgttccagactcaacttggaggatcatg
actacgctcaacatgttaggagggcggcaagtgattgcagcagtgaaatgggcaaaggca
ataccaggtttcaggaacttacacctggatgaccaaatgaccctactgcagtactcctgg
atgtttcttatggcatttgctctggggtggagatcatatagacaatcaagtgcaaacctg
ctgtgttttgctcctgatctgattattaatgagcagagaatgactctaccctgcatgtac
gaccaatgtaaacacatgctgtatgtttcctctgagttacacaggcttcaggtatcttat
gaagagtatctctgtatgaaaaccttactgcttctctcttcagttcctaaggacggtctg
aagagccaagagctatttgatgaaattagaatgacctacatcaaagagctaggaaaagcc
attgtcaagagggaaggaaactccagccagaactggcagcggttttatcaactgacaaaa
ctcttggattctatgcatgaagtggttgaaaatctccttaactattgcttccaaacattt
ttggataagaccatgagtattgaattccccgagatgttagctgaaatcatcaccaatcag
ataccaaaatattcaaatggaaatatcaaaaaacttctgtttcatcaaaagtga

DBGET integrated database retrieval system