KEGG   Homo sapiens (human): 2908Help
Entry
2908              CDS       T01001                                 

Gene name
NR3C1, GCCR, GCR, GCRST, GR, GRL
Definition
(RefSeq) nuclear receptor subfamily 3 group C member 1
  KO
K05771  glucocorticoid receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Disease
H00599  46,XX disorders of sex development (Disorders related to androgen excess)
H01702  Glucocorticoid resistance syndrome
H01709  Glucocorticoid-induced osteonecrosis
Drug target
Alclometasone (DG00415): D01820 D07116
Amcinonide: D01387
Beclometasone (DG00097): D00689 D07495
Betamethasone (DG00095): D00244 D00972 D01357 D01402 D01637 D02032 D02286
Budesonide: D00246
Ciclesonide: D01703
Clobetasol (DG00422): D01272 D07715
Clobetasone (DG00411): D01273 D07717
Clocortolone (DG00416): D02287 D03541 D07719
Cloprednol: D03561
Cortisone (DG00509): D00973 D07749
Cortivazol: D03594
Dagrocorat: D10617
Deflazacort: D03671
Deprodone propionate: D01434
Descinolone acetonide: D03691
Desonide: D03696
Desoximetasone: D03697
Dexamethasone (DG00011): D00292 D00975 D01510 D01615 D01632 D01948 D02174 D02591 D02592 D07073 D07796 D07797 D07798 D07799 D07800 D07801 D07802
Diflorasone (DG00418): D01327 D07827
Diflucortolone (DG00417): D01764 D03812 D03813
Difluprednate: D01266
Fluclorolone: D04201
Fludroxycortide: D00328
Flumetasone (DG00412): D01464 D04208
Flunisolide (DG01040): D00324 D04214
Fluocinolone acetonide: D01825
Fluocinonide: D00325
Fluocortin (DG00413): D04217 D07972
Fluocortolone (DG00295): D04218 D04219 D07973
Fluorometholone (DG00294): D01367 D04221
Flupamesone: D07975
Fluprednidene (DG00414): D07201 D07980
Fluprednisolone: D04227
Fluprednisolone valerate: D04228
Fluticasone (DG00420): D01708 D06315 D07981
Formocortal: D04244
Fosdagrocorat: D10634
Halcinonide: D01308
Halometasone: D07202
Halopredone (DG01376): D01743 D08036
Hydrocortisone (DG00012): D00088 D00165 D00976 D00977 D00978 D01442 D01619 D01886 D02288 D04467 D06876 D09796
Loteprednol (DG01127): D01689 D08147
Mapracorat: D10136
Medrysone: D02289
Meprednisone: D06673
Methylprednisolone (DG00410): D00407 D00751 D00979 D05000 D05001 D05002 D07203
Mifepristone: D00585
Mometasone (DG00419): D00690 D03325 D08227
Paramethasone (DG00508): D01229 D07464
Prednicarbate: D05601
Prednisolone (DG00093): D00472 D00980 D00981 D00982 D01239 D01998 D02156 D03301 D08412 D08413 D08414 D08415
Prednisone (DG00094): D00473 D08416
Prednival: D05603
Prednylidene: D07230
Proligestone: D08429
Resocortol (DG01545): D05719 D08476
Rimexolone: D05729
Ticabesone propionate: D06135
Tixocortol (DG00096): D06171 D08610
Tralonide: D06201
Triamcinolone (DG00010): D00385 D00983 D00984 D00985 D06216
Ulobetasol (DG00421): D04409 D08660
Vamorolone: D11000
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2908 (NR3C1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    2908 (NR3C1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:hsa03310]
    2908 (NR3C1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 estrogen-like
    2908 (NR3C1)
Nuclear receptors [BR:hsa03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   2908 (NR3C1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GCR Hormone_recep zf-C4
Motif
Other DBs
NCBI-GeneID: 2908
NCBI-ProteinID: NP_000167
OMIM: 138040
HGNC: 7978
Ensembl: ENSG00000113580
Vega: OTTHUMG00000129677
Pharos: P04150(Tclin)
UniProt: P04150 F1D8N4
Structure
PDB: 

Position
5q31.3
AA seq 777 aa AA seqDB search
MDSKESLTPGREENPSSVLAQERGDVMDFYKTLRGGATVKVSASSPSLAVASQSDSKQRR
LLVDFPKGSVSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDLK
LLEESIANLNRSTSVPENPKSSASTAVSAAPTEKEFPKTHSDVSSEQQHLKGQTGTNGGN
VKLYTTDQSTFDILQDLEFSSGSPGKETNESPWRSDLLIDENCLLSPLAGEDDSFLLEGN
SNEDCKPLILPDTKPKIKDNGDLVLSSPSNVTLPQVKTEKEDFIELCTPGVIKQEKLGTV
YCQASFPGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPIFNVIPPIPVG
SENWNRCQGSGDDNLTSLGTLNFPGRTVFSNGYSSPSMRPDVSSPPSSSSTATTGPPPKL
CLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRK
CLQAGMNLEARKTKKKIKGIQQATTGVSQETSENPGNKTIVPATLPQLTPTLVSLLEVIE
PEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSW
MFLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPCMYDQCKHMLYVSSELHRLQVSY
EEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTK
LLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK
NT seq 2334 nt NT seq  +upstreamnt  +downstreamnt
atggactccaaagaatcattaactcctggtagagaagaaaaccccagcagtgtgcttgct
caggagaggggagatgtgatggacttctataaaaccctaagaggaggagctactgtgaag
gtttctgcgtcttcaccctcactggctgtcgcttctcaatcagactccaagcagcgaaga
cttttggttgattttccaaaaggctcagtaagcaatgcgcagcagccagatctgtccaaa
gcagtttcactctcaatgggactgtatatgggagagacagaaacaaaagtgatgggaaat
gacctgggattcccacagcagggccaaatcagcctttcctcgggggaaacagacttaaag
cttttggaagaaagcattgcaaacctcaataggtcgaccagtgttccagagaaccccaag
agttcagcatccactgctgtgtctgctgcccccacagagaaggagtttccaaaaactcac
tctgatgtatcttcagaacagcaacatttgaagggccagactggcaccaacggtggcaat
gtgaaattgtataccacagaccaaagcacctttgacattttgcaggatttggagttttct
tctgggtccccaggtaaagagacgaatgagagtccttggagatcagacctgttgatagat
gaaaactgtttgctttctcctctggcgggagaagacgattcattccttttggaaggaaac
tcgaatgaggactgcaagcctctcattttaccggacactaaacccaaaattaaggataat
ggagatctggttttgtcaagccccagtaatgtaacactgccccaagtgaaaacagaaaaa
gaagatttcatcgaactctgcacccctggggtaattaagcaagagaaactgggcacagtt
tactgtcaggcaagctttcctggagcaaatataattggtaataaaatgtctgccatttct
gttcatggtgtgagtacctctggaggacagatgtaccactatgacatgaatacagcatcc
ctttctcaacagcaggatcagaagcctatttttaatgtcattccaccaattcccgttggt
tccgaaaattggaataggtgccaaggatctggagatgacaacttgacttctctggggact
ctgaacttccctggtcgaacagttttttctaatggctattcaagccccagcatgagacca
gatgtaagctctcctccatccagctcctcaacagcaacaacaggaccacctcccaaactc
tgcctggtgtgctctgatgaagcttcaggatgtcattatggagtcttaacttgtggaagc
tgtaaagttttcttcaaaagagcagtggaaggacagcacaattacctatgtgctggaagg
aatgattgcatcatcgataaaattcgaagaaaaaactgcccagcatgccgctatcgaaaa
tgtcttcaggctggaatgaacctggaagctcgaaaaacaaagaaaaaaataaaaggaatt
cagcaggccactacaggagtctcacaagaaacctctgaaaatcctggtaacaaaacaata
gttcctgcaacgttaccacaactcacccctaccctggtgtcactgttggaggttattgaa
cctgaagtgttatatgcaggatatgatagctctgttccagactcaacttggaggatcatg
actacgctcaacatgttaggagggcggcaagtgattgcagcagtgaaatgggcaaaggca
ataccaggtttcaggaacttacacctggatgaccaaatgaccctactgcagtactcctgg
atgtttcttatggcatttgctctggggtggagatcatatagacaatcaagtgcaaacctg
ctgtgttttgctcctgatctgattattaatgagcagagaatgactctaccctgcatgtac
gaccaatgtaaacacatgctgtatgtttcctctgagttacacaggcttcaggtatcttat
gaagagtatctctgtatgaaaaccttactgcttctctcttcagttcctaaggacggtctg
aagagccaagagctatttgatgaaattagaatgacctacatcaaagagctaggaaaagcc
attgtcaagagggaaggaaactccagccagaactggcagcggttttatcaactgacaaaa
ctcttggattctatgcatgaagtggttgaaaatctccttaactattgcttccaaacattt
ttggataagaccatgagtattgaattccccgagatgttagctgaaatcatcaccaatcag
ataccaaaatattcaaatggaaatatcaaaaaacttctgtttcatcaaaagtga

DBGET integrated database retrieval system