KEGG   Homo sapiens (human): 29080
Entry
29080             CDS       T01001                                 
Symbol
CCDC59, BR22, HSPC128, TAP26
Name
(RefSeq) coiled-coil domain containing 59
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: rRNA_processing
Other DBs
NCBI-GeneID: 29080
NCBI-ProteinID: NP_054886
OMIM: 619280
HGNC: 25005
Ensembl: ENSG00000133773
Pharos: Q9P031(Tdark)
UniProt: Q9P031
Position
12:complement(82352303..82358805)
AA seq 241 aa
MAPVRRSAKWRPGGIEARGEGVSTVGYRNKNVRQKTWRPNHPQAFVGSVREGQGFAFRRK
LKIQQSYKKLLRKEKKAQTSLESQFTDRYPDNLKHLYLAEEERHRKQARKVDHPLSEQVH
QPLLEEQCSIDEPLFEDQCSFDQPQPEEQCIKTVNSFTIPKKNKKKTSNQKAQEEYEQIQ
AKRAAKKQEFERRKQEREEAQRQYKKKKMEVFKILNKKTKKGQPNLNVQMEYLLQKIQEK
C
NT seq 726 nt   +upstreamnt  +downstreamnt
atggcgccggtgaggcggtccgcgaagtggcggcctggtggtattgaggcgcgtggtgaa
ggggtttccactgtcgggtacaggaataagaatgtgagacagaagacatggcggcctaac
cacccgcaagccttcgtggggagcgttcgcgagggacaaggctttgcttttcgaagaaaa
ctgaaaatacagcaaagttacaagaaattgctacggaaggaaaagaaggctcaaacgtca
ctggaatctcaattcacagatcgatacccagataatctgaaacatctctatttagctgaa
gaggaaagacataggaagcaagcaagaaaagtcgaccatcctttgtcagaacaagttcac
cagccgttgcttgaagaacagtgtagcattgacgagcctttatttgaagatcagtgtagc
tttgaccagcctcagccagaagaacaatgtattaaaacagtaaactcctttacaattcca
aagaaaaataaaaagaaaacatcaaatcaaaaagcacaagaagaatatgaacagatacaa
gccaaacgtgctgctaagaaacaagaattcgagaggagaaaacaggagagagaagaagcc
caaaggcagtacaaaaagaagaaaatggaagtgtttaaaatactgaacaaaaagactaaa
aagggccaaccaaacttgaatgtacaaatggagtaccttcttcaaaaaatacaagaaaaa
tgttaa

DBGET integrated database retrieval system