KEGG   Homo sapiens (human): 29082Help
Entry
29082             CDS       T01001                                 

Gene name
CHMP4A, C14orf123, CHMP4, CHMP4B, HSPC134, SHAX2, SNF7, SNF7-1, VPS32-1, VPS32A
Definition
(RefSeq) charged multivesicular body protein 4A
  KO
K12194  charged multivesicular body protein 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    29082 (CHMP4A)
  09143 Cell growth and death
   04217 Necroptosis
    29082 (CHMP4A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    29082 (CHMP4A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    29082 (CHMP4A)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    29082 (CHMP4A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   29082 (CHMP4A)
  Exosomal proteins of other body fluids (saliva and urine)
   29082 (CHMP4A)
  Exosomal proteins of colorectal cancer cells
   29082 (CHMP4A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Snf7 GHL5 Ribonuc_2-5A
Motif
Other DBs
NCBI-GeneID: 29082
NCBI-ProteinID: NP_054888
OMIM: 610051
HGNC: 20274
Ensembl: ENSG00000254505
Vega: OTTHUMG00000167036
Pharos: Q9BY43(Tbio)
UniProt: Q9BY43
Position
14q12
AA seq 222 aa AA seqDB search
MSGLGRLFGKGKKEKGPTPEEAIQKLKETEKILIKKQEFLEQKIQQELQTAKKYGTKNKR
AALQALRRKKRFEQQLAQTDGTLSTLEFQREAIENATTNAEVLRTMELAAQSMKKAYQDM
DIDKVDELMTDITEQQEVAQQISDAISRPMGFGDDVDEDELLEELEELEQEELAQELLNV
GDKEEEPSVKLPSVPSTHLPAGPAPKVDEDEEALKQLAEWVS
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgagtggtctcggcaggctcttcgggaaggggaagaaggagaaagggccaacccctgaa
gaagcaatacagaaactgaaggagacagagaagatactgatcaagaaacaggaatttttg
gagcagaagattcaacaggagctacaaacagccaagaagtatgggaccaagaataagaga
gctgccctacaggctttgcggaggaagaaaagattcgaacagcagctggcacaaactgac
gggacattatccaccctggagtttcagcgtgaggccattgagaatgccactaccaatgca
gaagtccttcgtaccatggagcttgctgcccaaagcatgaagaaggcctaccaggacatg
gacattgacaaggtagatgaactgatgactgacatcacggaacaacaggaggtggcccag
cagatctcagatgccatttctcggcctatgggctttggagatgatgtggatgaggatgaa
ctgctggaggagctagaggagctggagcaggaggaattggcccaggagttgttaaatgtg
ggcgacaaggaagaagaaccctcagtcaaattgcctagtgtaccttctactcatctgccg
gcagggccagctcccaaagtggatgaagatgaagaagcactaaagcagttggctgagtgg
gtatcctga

DBGET integrated database retrieval system