KEGG   Homo sapiens (human): 29087
Entry
29087             CDS       T01001                                 

Gene name
THYN1, HSPC144, MDS012, MY105, THY28, THY28KD
Definition
(RefSeq) thymocyte nuclear protein 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: EVE
Other DBs
NCBI-GeneID: 29087
NCBI-ProteinID: NP_001032382
OMIM: 613739
HGNC: 29560
Ensembl: ENSG00000151500
Vega: OTTHUMG00000167176
Pharos: Q9P016(Tdark)
UniProt: Q9P016 A0A024R3M1
Structure
PDB: 
3EOP 5J3E

Position
11q25
AA seq 225 aa
MSRPRKRLAGTSGSDKGLSGKRTKTENSGEALAKVEDSNPQKTSATKNCLKNLSSHWLMK
SEPESRLEKGVDVKFSIEDLKAQPKQTTCWDGVRNYQARNFLRAMKLGEEAFFYHSNCKE
PGIAGLMKIVKEAYPDHTQFEKNNPHYDPSSKEDNPKWSMVDVQFVRMMKRFIPLAELKS
YHQAHKATGGPLKNMVLFTRQRLSIQPLTQEEFDFVLSLEEKEPS
NT seq 678 nt   +upstreamnt  +downstreamnt
atgtcgagaccccggaagaggctggctgggacttctggttcagacaagggactatcagga
aaacgcaccaaaactgagaactcaggtgaggcattagctaaagtggaggactccaaccct
cagaagacttcagccactaaaaactgtttgaagaatctaagcagccactggctgatgaag
tcagagccagagagccgcctagagaaaggtgtagatgtgaagttcagcattgaggatctc
aaagcacagcccaaacagacaacatgctgggatggtgttcgtaactaccaggctcggaac
ttccttagagccatgaagctgggagaagaagccttcttctaccatagcaactgcaaagag
ccaggcatcgcaggactcatgaagatcgtgaaagaggcttacccagaccacacacagttt
gagaaaaacaatccccattatgacccatctagcaaagaggacaaccctaagtggtccatg
gtggatgtacagtttgttcggatgatgaaacgtttcattcccctggctgagctcaaatcc
tatcatcaagctcacaaagctactggtggccccttaaaaaatatggttctcttcactcgc
cagagattatcaatccagcccctgacccaggaagagtttgattttgttttgagcctggag
gaaaaggaaccaagttaa

DBGET integrated database retrieval system