KEGG   Homo sapiens (human): 29089Help
Entry
29089             CDS       T01001                                 

Gene name
UBE2T, FANCT, HSPC150, PIG50
Definition
(RefSeq) ubiquitin conjugating enzyme E2 T
  KO
K13960  ubiquitin-conjugating enzyme E2 T [EC:2.3.2.23]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03460  Fanconi anemia pathway
Disease
H00238  Fanconi anemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    29089 (UBE2T)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    29089 (UBE2T)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    29089 (UBE2T)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     29089 (UBE2T)
Ubiquitin system [BR:hsa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   29089 (UBE2T)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    FA core complex binding factors
     29089 (UBE2T)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UQ_con Prok-E2_B RWD
Motif
Other DBs
NCBI-GeneID: 29089
NCBI-ProteinID: NP_054895
OMIM: 610538
HGNC: 25009
Ensembl: ENSG00000077152
Vega: OTTHUMG00000041392
Pharos: Q9NPD8(Tbio)
UniProt: Q9NPD8 A0A024R9A9
Structure
PDB: 

Position
1q32.1
AA seq 197 aa AA seqDB search
MQRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPER
YPFEPPQIRFLTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNP
DDPLMADISSEFKYNKPAFLKNARQWTEKHARQKQKADEEEMLDNLPEAGDSRVHNSTQK
RKASQLVGIEKKFHPDV
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgcagagagcttcacgtctgaagagagagctgcacatgttagccacagagccaccccca
ggcatcacatgttggcaagataaagaccaaatggatgacctgcgagctcaaatattaggt
ggagccaacacaccttatgagaaaggtgtttttaagctagaagttatcattcctgagagg
tacccatttgaacctcctcagatccgatttctcactccaatttatcatccaaacattgat
tctgctggaaggatttgtctggatgttctcaaattgccaccaaaaggtgcttggagacca
tccctcaacatcgcaactgtgttgacctctattcagctgctcatgtcagaacccaaccct
gatgacccgctcatggctgacatatcctcagaatttaaatataataagccagccttcctc
aagaatgccagacagtggacagagaagcatgcaagacagaaacaaaaggctgatgaggaa
gagatgcttgataatctaccagaggctggtgactccagagtacacaactcaacacagaaa
aggaaggccagtcagctagtaggcatagaaaagaaatttcatcctgatgtttag

DBGET integrated database retrieval system