KEGG   Homo sapiens (human): 29093
Entry
29093             CDS       T01001                                 

Gene name
MRPL22, HSPC158, L22mt, MRP-L22, MRP-L25, RPML25
Definition
(RefSeq) mitochondrial ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
hsa  Homo sapiens (human)
Pathway
hsa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    29093 (MRPL22)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:hsa03011]
    29093 (MRPL22)
Ribosome [BR:hsa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    29093 (MRPL22)
  Bacteria
    29093 (MRPL22)
  Archaea
    29093 (MRPL22)
SSDB
Motif
Pfam: Ribosomal_L22
Other DBs
NCBI-GeneID: 29093
NCBI-ProteinID: NP_054899
OMIM: 611835
HGNC: 14480
Ensembl: ENSG00000082515
Vega: OTTHUMG00000130190
Pharos: Q9NWU5(Tdark)
UniProt: Q9NWU5
Structure
PDB: 
5OOM 5OOL 3J7Y 3IY9

Position
5q33.2
AA seq 206 aa
MAAAVLGQLGALWIHNLRSRGKLALGVLPQSYIHTSASLDISRKWEKKNKIVYPPQLPGE
PRRPAEIYHCRRQIKYSKDKMWYLAKLIRGMSIDQALAQLEFNDKKGAKIIKEVLLEAQD
MAVRDHNVEFRSNLYIAESTSGRGQCLKRIRYHGRGRFGIMEKVYCHYFVKLVEGPPPPP
EPPKTAVAHAKEYIQQLRSRTIVHTL
NT seq 621 nt   +upstreamnt  +downstreamnt
atggcggcggcagtactgggacagttgggtgcgttatggatacataacctgaggagccgg
gggaagctggccttgggtgttttacctcaatcatatatccacacaagtgcttctcttgac
atttctcgaaaatgggagaagaagaataaaattgtttatcctccacaactgcctggagaa
cctcggagaccagcagaaatctaccactgtcgaagacaaataaaatatagcaaagacaag
atgtggtatttggcaaaattgatacgaggaatgtctattgaccaggctttggctcagttg
gaattcaatgacaaaaaaggggccaaaataattaaagaggttctcttagaagcacaagat
atggcagtgagagaccataacgtggaattcaggtccaatttatatatagctgagtccacc
tcaggacgaggccagtgcctgaaacgcatccgctaccatggcagaggtcgctttgggatc
atggagaaggtttattgccattattttgtgaagttggtggaagggcccccacctccacct
gagccaccaaagacggcagttgcccatgccaaagagtatattcagcagcttcgcagccgg
accatcgttcacactctatga

DBGET integrated database retrieval system