KEGG   Homo sapiens (human): 29094Help
Entry
29094             CDS       T01001                                 

Gene name
LGALSL, GRP, HSPC159
Definition
(RefSeq) galectin like
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Gal-bind_lectin
Motif
Other DBs
NCBI-GeneID: 29094
NCBI-ProteinID: NP_054900
OMIM: 617902
HGNC: 25012
Ensembl: ENSG00000119862
Vega: OTTHUMG00000129541
Pharos: Q3ZCW2(Tbio)
UniProt: Q3ZCW2
Structure
PDB: 

Position
2p14
AA seq 172 aa AA seqDB search
MAGSVADSDAVVKLDDGHLNNSLSSPVQADVYFPRLIVPFCGHIKGGMRPGKKVLVMGIV
DLNPESFAISLTCGDSEDPPADVAIELKAVFTDRQLLRNSCISGERGEEQSAIPYFPFIP
DQPFRVEILCEHPRFRVFVDGHQLFDFYHRIQTLSAIDTIKINGDLQITKLG
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggcgggatcagtggccgacagcgatgccgtggtgaaactagatgatggccatttaaac
aactctttgagctctccagttcaagcggacgtgtacttcccacgactgatagttccattt
tgtgggcacattaaaggtggcatgagaccaggcaagaaggtgttagtgatgggcatcgta
gacctcaacccagagagctttgcaatcagcttgacctgtggggactcagaagaccctcct
gccgatgtggcaatcgaactcaaagctgtgttcacagatcggcagctactcagaaattct
tgtatatctggggagaggggtgaagaacagtcagcaatcccttactttccattcattcca
gaccagccattcagggtggaaattctttgtgagcacccacgtttccgagtgtttgtggat
ggacaccaactttttgatttttaccatcgcattcaaacgttatctgcaattgacaccata
aagataaatggagacctccagatcaccaagcttggctga

DBGET integrated database retrieval system