KEGG   Homo sapiens (human): 29095
Entry
29095             CDS       T01001                                 
Symbol
ORMDL2, HSPC160, MST095, MSTP095, adoplin-2
Name
(RefSeq) ORMDL sphingolipid biosynthesis regulator 2
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: ORMDL
Other DBs
NCBI-GeneID: 29095
NCBI-ProteinID: NP_054901
OMIM: 610074
HGNC: 16037
Ensembl: ENSG00000123353
Pharos: Q53FV1(Tdark)
UniProt: Q53FV1
Position
12:55818041..55821879
AA seq 153 aa
MNVGVAHSEVNPNTRVMNSRGIWLAYIILVGLLHMVLLSIPFFSIPVVWTLTNVIHNLAT
YVFLHTVKGTPFETPDQGKARLLTHWEQMDYGLQFTSSRKFLSISPIVLYLLASFYTKYD
AAHFLINTASLLSVLLPKLPQFHGVRVFGINKY
NT seq 462 nt   +upstreamnt  +downstreamnt
atgaatgtgggggtggcacacagcgaagtaaaccccaacacccgagtgatgaatagccga
ggcatctggctggcctacatcatcttggtaggattgctgcatatggttctactcagcatc
cccttcttcagcattcctgttgtctggaccctgaccaacgtcatccataacctggctacg
tatgtcttccttcatacggtgaaagggacaccctttgagactcctgaccaaggaaaggct
cggctactgacacactgggagcaaatggactatgggctccagtttacctcttcccgcaag
ttcctcagcatctctcctattgtgctctatctcctggccagcttctataccaagtatgat
gctgcgcacttcctcatcaacacagcctcattgctaagtgtactgctgccgaagttgccc
cagttccatggggttcgtgtctttggcatcaacaaatactga

DBGET integrated database retrieval system