KEGG   Homo sapiens (human): 29099
Entry
29099             CDS       T01001                                 

Gene name
COMMD9, C11orf55, HSPC166, LINC00610
Definition
(RefSeq) COMM domain containing 9
  KO
K22565  COMM domain containing 9
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    29099 (COMMD9)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Multi subunit type E3 associated proteins
    29099 (COMMD9)
SSDB
Motif
Pfam: COMM_domain COR
Other DBs
NCBI-GeneID: 29099
NCBI-ProteinID: NP_054905
OMIM: 612299
HGNC: 25014
Ensembl: ENSG00000110442
Vega: OTTHUMG00000166333
Pharos: Q9P000(Tdark)
UniProt: Q9P000 Q53FR9
Structure
PDB: 
4OE9 6BP6 4NKN

Position
11p13
AA seq 198 aa
MAALTAEHFAALQSLLKASSKDVVRQLCQESFSSSALGLKKLLDVTCSSLSVTQEEAEEL
LQALHRLTRLVAFRDLSSAEAILALFPENFHQNLKNLLTKIILEHVSTWRTEAQANQISL
PRLVDLDWRVDIKTSSDSISRMAVPTCLLQMKIQEDPSLCGDKPSISAVTVELSKETLDT
MLDGLGRIRDQLSAVASK
NT seq 597 nt   +upstreamnt  +downstreamnt
atggctgccctgacagcggagcattttgcagcactccagagcctgctcaaggcctcctcg
aaagatgttgtcagacagctgtgtcaagaaagcttttccagttcagcccttggcttgaaa
aaactcttggatgttacatgttccagcttgtctgtgacccaggaggaggcagaggaactg
ctccaggctctgcaccgcctcactaggctggtggcattccgtgacctgtcctctgccgag
gcaattctggctctctttccagaaaatttccaccaaaacctcaaaaacctgctgacaaag
atcatcctagaacatgtgtctacttggagaaccgaagcccaggcaaatcagatctctctg
ccacgcctggtcgatctggactggagagtggatatcaaaacctcctcagacagcatcagc
cgcatggccgtccccacctgcctgctccagatgaagatccaagaagatcccagcctatgc
ggagacaaaccctccatctcagctgtcaccgtggagctgagcaaagaaacactggacacc
atgttagatggcctgggccgcatccgagaccaactctctgccgtggccagtaaatga

DBGET integrated database retrieval system