KEGG   Homo sapiens (human): 291
Entry
291               CDS       T01001                                 

Symbol
SLC25A4, AAC1, ANT, ANT_1, ANT1, MTDPS12, MTDPS12A, PEO2, PEO3, PEOA2, T1
Name
(RefSeq) solute carrier family 25 member 4
  KO
K05863  solute carrier family 25 (mitochondrial adenine nucleotide translocator), member 4/5/6/31
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04217  Necroptosis
hsa04218  Cellular senescence
hsa04613  Neutrophil extracellular trap formation
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05164  Influenza A
hsa05166  Human T-cell leukemia virus 1 infection
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05415  Diabetic cardiomyopathy
Network
nt06410  Calcium signaling
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06462  Spinocerebellar ataxia
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
nt06465  Prion disease
  Element
N00957  Mutation-caused abberant ATXN2/3 to mGluR5-Ca2+ -apoptotic pathway
N00967  VGCC-Ca2+ -apoptotic pathway
N00984  mGluR5-Ca2+ -apoptotic pathway
N00985  Mutation-caused aberrant Htt to mGluR5-Ca2+ -apoptotic pathway
N00987  Mutation-caused aberrant Htt to transport of calcium
N01000  mAChR-Ca2+ -apoptotic pathway
N01001  Mutation-caused aberrant Abeta to mAchR-Ca2+ -apoptotic pathway
N01002  Mutation-caused aberrant Abeta to mGluR5-Ca2+ -apoptotic pathway
N01003  Mutation-caused aberrant Abeta to transport of calcium
N01004  Mutation-caused aberrant Abeta to VGCC-Ca2+ -apoptotic pathway
N01006  Mutation-caused aberrant Abeta to VGCC-Ca2+ -apoptotic pathway
N01007  Mutation-caused aberrant PSEN to mGluR5-Ca2+ -apoptotic pathway
N01008  Mutation-caused aberrant PSEN1 to mGluR5-Ca2+ -apoptotic pathway
N01031  Mutation-caused aberrant SNCA to VGCC-Ca2+ -apoptotic pathway
N01151  Mutation-inactivated SIGMAR1 to Ca2+ -apoptotic pathway
N01199  Scrapie conformation PrPSc to mGluR5-Ca2+ -apoptotic pathway
N01200  Scrapie conformation PrPSc to transport of calcium
Disease
H00469  Mitochondrial DNA depletion syndrome
H01118  Progressive external ophthalmoplegia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    291 (SLC25A4)
   04022 cGMP-PKG signaling pathway
    291 (SLC25A4)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    291 (SLC25A4)
   04218 Cellular senescence
    291 (SLC25A4)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    291 (SLC25A4)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    291 (SLC25A4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    291 (SLC25A4)
   05164 Influenza A
    291 (SLC25A4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    291 (SLC25A4)
   05012 Parkinson disease
    291 (SLC25A4)
   05016 Huntington disease
    291 (SLC25A4)
   05017 Spinocerebellar ataxia
    291 (SLC25A4)
   05020 Prion disease
    291 (SLC25A4)
   05022 Pathways of neurodegeneration - multiple diseases
    291 (SLC25A4)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    291 (SLC25A4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    291 (SLC25A4)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    291 (SLC25A4)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    291 (SLC25A4)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   291 (SLC25A4)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 291
NCBI-ProteinID: NP_001142
OMIM: 103220
HGNC: 10990
Ensembl: ENSG00000151729
Vega: OTTHUMG00000134299
Pharos: P12235(Tbio)
UniProt: P12235 A0A0S2Z3H3
Position
4q35.1
AA seq 298 aa
MGDHAWSFLKDFLAGGVAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVR
IPKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQLFLGGVDRHKQFWRYFAGNLASG
GAAGATSLCFVYPLDFARTRLAADVGKGAAQREFHGLGDCIIKIFKSDGLRGLYQGFNVS
VQGIIIYRAAYFGVYDTAKGMLPDPKNVHIFVSWMIAQSVTAVAGLVSYPFDTVRRRMMM
QSGRKGADIMYTGTVDCWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYV
NT seq 897 nt   +upstreamnt  +downstreamnt
atgggtgatcacgcttggagcttcctaaaggacttcctggccgggggcgtcgccgctgcc
gtctccaagaccgcggtcgcccccatcgagagggtcaaactgctgctgcaggtccagcat
gccagcaaacagatcagtgctgagaagcagtacaaagggatcattgattgtgtggtgaga
atccctaaggagcagggcttcctctccttctggaggggtaacctggccaacgtgatccgt
tacttccccacccaagctctcaacttcgccttcaaggacaagtacaagcagctcttctta
gggggtgtggatcggcataagcagttctggcgctactttgctggtaacctggcgtccggt
ggggccgctggggccacctccctttgctttgtctacccgctggactttgctaggaccagg
ttggctgctgatgtgggcaagggcgccgcccagcgtgagttccatggtctgggcgactgt
atcatcaagatcttcaagtctgatggcctgagggggctctaccagggtttcaacgtctct
gtccaaggcatcattatctatagagctgcctacttcggagtctatgatactgccaagggg
atgctgcctgaccccaagaacgtgcacatttttgtgagctggatgattgcccagagtgtg
acggcagtcgcagggctggtgtcctacccctttgacactgttcgtcgtagaatgatgatg
cagtccggccggaaaggggccgatattatgtacacggggacagttgactgctggaggaag
attgcaaaagacgaaggagccaaggccttcttcaaaggtgcctggtccaatgtgctgaga
ggcatgggcggtgcttttgtattggtgttgtatgatgagatcaaaaaatatgtctaa

DBGET integrated database retrieval system