KEGG   Homo sapiens (human): 291Help
Entry
291               CDS       T01001                                 

Gene name
SLC25A4, AAC1, ANT, ANT_1, ANT1, MTDPS12, MTDPS12A, PEO2, PEO3, PEOA2, T1
Definition
(RefSeq) solute carrier family 25 member 4
  KO
K05863  solute carrier family 25 (mitochondrial adenine nucleotide translocator), member 4/5/6/31
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04217  Necroptosis
hsa04218  Cellular senescence
hsa05012  Parkinson disease
hsa05016  Huntington disease
hsa05166  Human T-cell leukemia virus 1 infection
Disease
H00469  Mitochondrial DNA depletion syndrome
H01118  Progressive external ophthalmoplegia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    291 (SLC25A4)
   04022 cGMP-PKG signaling pathway
    291 (SLC25A4)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    291 (SLC25A4)
   04218 Cellular senescence
    291 (SLC25A4)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05012 Parkinson disease
    291 (SLC25A4)
   05016 Huntington disease
    291 (SLC25A4)
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    291 (SLC25A4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    291 (SLC25A4)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    291 (SLC25A4)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    291 (SLC25A4)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC25: Mitochondrial carrier
   291 (SLC25A4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mito_carr
Motif
Other DBs
NCBI-GeneID: 291
NCBI-ProteinID: NP_001142
OMIM: 103220
HGNC: 10990
Ensembl: ENSG00000151729
Vega: OTTHUMG00000134299
Pharos: P12235(Tbio)
UniProt: P12235 A0A0S2Z3H3
Position
4q35.1
AA seq 298 aa AA seqDB search
MGDHAWSFLKDFLAGGVAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVR
IPKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQLFLGGVDRHKQFWRYFAGNLASG
GAAGATSLCFVYPLDFARTRLAADVGKGAAQREFHGLGDCIIKIFKSDGLRGLYQGFNVS
VQGIIIYRAAYFGVYDTAKGMLPDPKNVHIFVSWMIAQSVTAVAGLVSYPFDTVRRRMMM
QSGRKGADIMYTGTVDCWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYV
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatcacgcttggagcttcctaaaggacttcctggccgggggcgtcgccgctgcc
gtctccaagaccgcggtcgcccccatcgagagggtcaaactgctgctgcaggtccagcat
gccagcaaacagatcagtgctgagaagcagtacaaagggatcattgattgtgtggtgaga
atccctaaggagcagggcttcctctccttctggaggggtaacctggccaacgtgatccgt
tacttccccacccaagctctcaacttcgccttcaaggacaagtacaagcagctcttctta
gggggtgtggatcggcataagcagttctggcgctactttgctggtaacctggcgtccggt
ggggccgctggggccacctccctttgctttgtctacccgctggactttgctaggaccagg
ttggctgctgatgtgggcaagggcgccgcccagcgtgagttccatggtctgggcgactgt
atcatcaagatcttcaagtctgatggcctgagggggctctaccagggtttcaacgtctct
gtccaaggcatcattatctatagagctgcctacttcggagtctatgatactgccaagggg
atgctgcctgaccccaagaacgtgcacatttttgtgagctggatgattgcccagagtgtg
acggcagtcgcagggctggtgtcctacccctttgacactgttcgtcgtagaatgatgatg
cagtccggccggaaaggggccgatattatgtacacggggacagttgactgctggaggaag
attgcaaaagacgaaggagccaaggccttcttcaaaggtgcctggtccaatgtgctgaga
ggcatgggcggtgcttttgtattggtgttgtatgatgagatcaaaaaatatgtctaa

DBGET integrated database retrieval system