KEGG   Homo sapiens (human): 29100Help
Entry
29100             CDS       T01001                                 

Gene name
TMEM208, HSPC171
Definition
(RefSeq) transmembrane protein 208
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: TMEM208_SND2 Halogen_Hydrol
Motif
Other DBs
NCBI-GeneID: 29100
NCBI-ProteinID: NP_054906
HGNC: 25015
Ensembl: ENSG00000168701
Vega: OTTHUMG00000173064
Pharos: Q9BTX3(Tdark)
UniProt: Q9BTX3
Position
16q22.1
AA seq 173 aa AA seqDB search
MAPKGKVGTRGKKQIFEENRETLKFYLRIILGANAIYCLVTLVFFYSSASFWAWLALGFS
LAVYGASYHSMSSMARAAFSEDGALMDGGMDLNMEQGMAEHLKDVILLTAIVQVLSCFSL
YVWSFWLLAPGRALYLLWVNVLGPWFTADSGTPAPEHNEKRQRRQERRQMKRL
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccaagggcaaagtgggcacgagagggaagaagcagatatttgaagagaacaga
gagactctgaagttctacctgcggatcatactgggggccaatgccatttactgccttgtg
acgttggtcttcttttactcatctgcctcattttgggcctggttggccctgggctttagt
ctggcagtgtatggggccagctaccactctatgagctcgatggcacgagcagcgttctct
gaggatggggccctgatggatggtggcatggacctcaacatggagcagggcatggcagag
caccttaaggatgtgatcctactgacagccatcgtgcaggtgctcagctgcttctctctc
tatgtctggtccttctggcttctggctccaggccgggccctttacctcctgtgggtgaat
gtgctgggcccctggttcactgcagacagtggcaccccagcaccagagcacaatgagaaa
cggcagcgccgacaggagcggcggcagatgaagcggttatag

DBGET integrated database retrieval system