KEGG   Homo sapiens (human): 29105
Entry
29105             CDS       T01001                                 
Symbol
CFAP20, BUG22, C16orf80, EVORF, GTL3, fSAP23
Name
(RefSeq) cilia and flagella associated protein 20
  KO
K25470  cilia- and flagella-associated protein 20
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:hsa03037]
    29105 (CFAP20)
Cilium and associated proteins [BR:hsa03037]
 Motile cilia and associated proteins
  Other motile cilia associated proteins
   29105 (CFAP20)
SSDB
Motif
Pfam: CFA20_dom
Other DBs
NCBI-GeneID: 29105
NCBI-ProteinID: NP_037374
OMIM: 617906
HGNC: 29523
Ensembl: ENSG00000070761
Pharos: Q9Y6A4(Tbio)
UniProt: Q9Y6A4
Position
16:complement(58113592..58129381)
AA seq 193 aa
MFKNTFQSGFLSILYSIGSKPLQIWDKKVRNGHIKRITDNDIQSLVLEIEGTNVSTTYIT
CPADPKKTLGIKLPFLVMIIKNLKKYFTFEVQVLDDKNVRRRFRASNYQSTTRVKPFICT
MPMRLDDGWNQIQFNLLDFTRRAYGTNYIETLRVQIHANCRIRRVYFSDRLYSEDELPAE
FKLYLPVQNKAKQ
NT seq 582 nt   +upstreamnt  +downstreamnt
atgttcaaaaacacgttccagagcggcttcctctccatcctctacagcatcggcagcaag
cctctgcaaatctgggacaaaaaggtacggaatggccacatcaaaagaatcactgataat
gacatccagtccctggtgctagagattgaagggacaaatgtaagcaccacatatatcaca
tgccctgcagaccccaagaagacgctgggaattaaacttcctttccttgtcatgattatc
aaaaacctgaagaagtattttaccttcgaagtgcaggtactagatgacaagaatgtgcgt
cgtcgctttcgggcaagtaactaccagagcaccacccgggtcaaacccttcatctgcacc
atgcccatgcggctggatgacggctggaaccagattcagttcaacttgctagacttcaca
cggcgagcatacggcaccaattacatcgagaccctcagagtgcagatccatgcaaattgt
cgcatccgacgggtttacttctcagacagactctactcagaagatgagctgccggcagag
ttcaaactgtatctcccagttcagaacaaggcaaagcaataa

DBGET integrated database retrieval system