KEGG   Homo sapiens (human): 29106Help
Entry
29106             CDS       T01001                                 

Gene name
SCG3, SGIII
Definition
(RefSeq) secretogranin III
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: SGIII DUF2680 DUF1974
Motif
Other DBs
NCBI-GeneID: 29106
NCBI-ProteinID: NP_037375
OMIM: 611796
HGNC: 13707
Ensembl: ENSG00000104112
Vega: OTTHUMG00000131748
Pharos: Q8WXD2(Tbio)
UniProt: Q8WXD2
Position
15q21.2
AA seq 468 aa AA seqDB search
MGFLGTGTWILVLVLPIQAFPKPGGSQDKSLHNRELSAERPLNEQIAEAEEDKIKKTYPP
ENKPGQSNYSFVDNLNLLKAITEKEKIEKERQSIRSSPLDNKLNVEDVDSTKNRKLIDDY
DSTKSGLDHKFQDDPDGLHQLDGTPLTAEDIVHKIAARIYEENDRAVFDKIVSKLLNLGL
ITESQAHTLEDEVAEVLQKLISKEANNYEEDPNKPTSWTENQAGKIPEKVTPMAAIQDGL
AKGENDETVSNTLTLTNGLERRTKTYSEDNFEELQYFPNFYALLKSIDSEKEAKEKETLI
TIMKTLIDFVKMMVKYGTISPEEGVSYLENLDEMIALQTKNKLEKNATDNISKLFPAPSE
KSHEETDSTKEEAAKMEKEYGSLKDSTKDDNSNPGGKTDEPKGKTEAYLEAIRKNIEWLK
KHDKKGNKEDYDLSKMRDFINKQADAYVEKGILDKEEAEAIKRIYSSL
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggggttcctcgggaccggcacttggattctggtgttagtgctcccgattcaagctttc
cccaaacctggaggaagccaagacaaatctctacataatagagaattaagtgcagaaaga
cctttgaatgaacagattgctgaagcagaagaagacaagattaaaaaaacatatcctcca
gaaaacaagccaggtcagagcaactattcttttgttgataacttgaacctgctaaaggca
ataacagaaaaggaaaaaattgagaaagaaagacaatctataagaagctccccacttgat
aataagttgaatgtggaagatgttgattcaaccaagaatcgaaaactgatcgatgattat
gactctactaagagtggattggatcataaatttcaagatgatccagatggtcttcatcaa
ctagacgggactcctttaaccgctgaagacattgtccataaaatcgctgccaggatttat
gaagaaaatgacagagccgtgtttgacaagattgtttctaaactacttaatctcggcctt
atcacagaaagccaagcacatacactggaagatgaagtagcagaggttttacaaaaatta
atctcaaaggaagccaacaattatgaggaggatcccaataagcccacaagctggactgag
aatcaggctggaaaaataccagagaaagtgactccaatggcagcaattcaagatggtctt
gctaagggagaaaacgatgaaacagtatctaacacattaaccttgacaaatggcttggaa
aggagaactaaaacctacagtgaagacaactttgaggaactccaatatttcccaaatttc
tatgcgctactgaaaagtattgattcagaaaaagaagcaaaagagaaagaaacactgatt
actatcatgaaaacactgattgactttgtgaagatgatggtgaaatatggaacaatatct
ccagaagaaggtgtttcctaccttgaaaacttggatgaaatgattgctcttcagaccaaa
aacaagctagaaaaaaatgctactgacaatataagcaagcttttcccagcaccatcagag
aagagtcatgaagaaacagacagtaccaaggaagaagcagctaagatggaaaaggaatat
ggaagcttgaaggattccacaaaagatgataactccaacccaggaggaaagacagatgaa
cccaaaggaaaaacagaagcctatttggaagccatcagaaaaaatattgaatggttgaag
aaacatgacaaaaagggaaataaagaagattatgacctttcaaagatgagagacttcatc
aataaacaagctgatgcttatgtggagaaaggcatccttgacaaggaagaagccgaggcc
atcaagcgcatttatagcagcctgtaa

DBGET integrated database retrieval system