KEGG   Homo sapiens (human): 29107Help
Entry
29107             CDS       T01001                                 

Gene name
NXT1, MTR2, P15
Definition
(RefSeq) nuclear transport factor 2 like export factor 1
  KO
K14285  NTF2-related export protein 1/2
Organism
hsa  Homo sapiens (human)
Pathway
hsa03008  Ribosome biogenesis in eukaryotes
hsa03013  RNA transport
hsa03015  mRNA surveillance pathway
hsa05164  Influenza A
Module
hsa_M00430  Exon junction complex (EJC)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    29107 (NXT1)
   03015 mRNA surveillance pathway
    29107 (NXT1)
   03008 Ribosome biogenesis in eukaryotes
    29107 (NXT1)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    29107 (NXT1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     29107 (NXT1)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    29107 (NXT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NTF2
Motif
Other DBs
NCBI-GeneID: 29107
NCBI-ProteinID: NP_037380
OMIM: 605811
HGNC: 15913
Ensembl: ENSG00000132661
Vega: OTTHUMG00000032059
Pharos: Q9UKK6(Tbio)
UniProt: Q9UKK6
Structure
PDB: 

Position
20p11.21
AA seq 140 aa AA seqDB search
MASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESLSE
FFEMLPSSEFQISVVDCQPVHDEATPSQTTVLVVICGSVKFEGNKQRDFNQNFILTAQAS
PSNTVWKIASDCFRFQDWAS
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggcatctgtggatttcaagacctatgtggatcaggcctgcagagctgctgaggagttt
gtcaatgtctactacaccaccatggataagcggcggcgtttgctgtcccgcctgtacatg
ggcacagccaccctggtctggaatggcaatgctgtttcaggacaagaatccttgagtgag
ttttttgaaatgttgccttccagcgagttccaaatcagcgtggtagactgccagcctgtt
catgatgaagccacaccaagccagaccacggtccttgttgtcatctgtggatcagtgaag
tttgaggggaacaaacaacgggacttcaaccagaacttcatcctgaccgcccaggcctca
cccagcaacacagtgtggaagatcgcaagtgactgcttccgcttccaggactgggccagc
tag

DBGET integrated database retrieval system