KEGG   Homo sapiens (human): 29108Help
Entry
29108             CDS       T01001                                 

Gene name
PYCARD, ASC, CARD5, TMS, TMS-1, TMS1
Definition
(RefSeq) PYD and CARD domain containing
  KO
K12799  apoptosis-associated speck-like protein containing a CARD
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa04621  NOD-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04625  C-type lectin receptor signaling pathway
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05134  Legionellosis
hsa05164  Influenza A
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    29108 (PYCARD)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    29108 (PYCARD)
   04623 Cytosolic DNA-sensing pathway
    29108 (PYCARD)
   04625 C-type lectin receptor signaling pathway
    29108 (PYCARD)
 09160 Human Diseases
  09171 Infectious diseases: Bacterial
   05132 Salmonella infection
    29108 (PYCARD)
   05133 Pertussis
    29108 (PYCARD)
   05134 Legionellosis
    29108 (PYCARD)
  09172 Infectious diseases: Viral
   05164 Influenza A
    29108 (PYCARD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CARD PYRIN
Motif
Other DBs
NCBI-GeneID: 29108
NCBI-ProteinID: NP_037390
OMIM: 606838
HGNC: 16608
Ensembl: ENSG00000103490
Vega: OTTHUMG00000176753
Pharos: Q9ULZ3(Tbio)
UniProt: Q9ULZ3
Structure
PDB: 

Position
16p11.2
AA seq 195 aa AA seqDB search
MGRARDAILDALENLTAEELKKFKLKLLSVPLREGYGRIPRGALLSMDALDLTDKLVSFY
LETYGAELTANVLRDMGLQEMAGQLQAATHQGSGAAPAGIQAPPQSAAKPGLHFIDQHRA
ALIARVTNVEWLLDALYGKVLTDEQYQAVRAEPTNPSKMRKLFSFTPAWNWTCKDLLLQA
LRESQSYLVEDLERS
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggggcgcgcgcgcgacgccatcctggatgcgctggagaacctgaccgccgaggagctc
aagaagttcaagctgaagctgctgtcggtgccgctgcgcgagggctacgggcgcatcccg
cggggcgcgctgctgtccatggacgccttggacctcaccgacaagctggtcagcttctac
ctggagacctacggcgccgagctcaccgctaacgtgctgcgcgacatgggcctgcaggag
atggccgggcagctgcaggcggccacgcaccagggctctggagccgcgccagctgggatc
caggcccctcctcagtcggcagccaagccaggcctgcactttatagaccagcaccgggct
gcgcttatcgcgagggtcacaaacgttgagtggctgctggatgctctgtacgggaaggtc
ctgacggatgagcagtaccaggcagtgcgggccgagcccaccaacccaagcaagatgcgg
aagctcttcagtttcacaccagcctggaactggacctgcaaggacttgctcctccaggcc
ctaagggagtcccagtcctacctggtggaggacctggagcggagctga

DBGET integrated database retrieval system