KEGG   Homo sapiens (human): 29117Help
Entry
29117             CDS       T01001                                 

Gene name
BRD7, BP75, CELTIX1, NAG4
Definition
(RefSeq) bromodomain containing 7
  KO
K11723  bromodomain-containing protein 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    29117 (BRD7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    29117 (BRD7)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Chromatin remodeling factors
   Other chromatin remodeling factors
    29117 (BRD7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF3512 Bromodomain GntR HcyBio
Motif
Other DBs
NCBI-GeneID: 29117
NCBI-ProteinID: NP_037395
OMIM: 618489
HGNC: 14310
Ensembl: ENSG00000166164
Vega: OTTHUMG00000133170
Pharos: Q9NPI1(Tbio)
UniProt: Q9NPI1
Structure
PDB: 

Position
16q12.1
AA seq 651 aa AA seqDB search
MGKKHKKHKSDKHLYEEYVEKPLKLVLKVGGNEVTELSTGSSGHDSSLFEDKNDHDKHKD
RKRKKRKKGEKQIPGEEKGRKRRRVKEDKKKRDRDRVENEAEKDLQCHAPVRLDLPPEKP
LTSSLAKQEEVEQTPLQEALNQLMRQLQRKDPSAFFSFPVTDFIAPGYSMIIKHPMDFST
MKEKIKNNDYQSIEELKDNFKLMCTNAMIYNKPETIYYKAAKKLLHSGMKILSQERIQSL
KQSIDFMADLQKTRKQKDGTDTSQSGEDGGCWQREREDSGDAEAHAFKSPSKENKKKDKD
MLEDKFKSNNLEREQEQLDRIVKESGGKLTRRLVNSQCEFERRKPDGTTTLGLLHPVDPI
VGEPGYCPVRLGMTTGRLQSGVNTLQGFKEDKRNKVTPVLYLNYGPYSSYAPHYDSTFAN
ISKDDSDLIYSTYGEDSDLPSDFSIHEFLATCQDYPYVMADSLLDVLTKGGHSRTLQEME
MSLPEDEGHTRTLDTAKEMEITEVEPPGRLDSSTQDRLIALKAVTNFGVPVEVFDSEEAE
IFQKKLDETTRLLRELQEAQNERLSTRPPPNMICLLGPSYREMHLAEQVTNNLKELAQQV
TPGDIVSTYGVRKAMGISIPSPVMENNFVDLTEDTEEPKKTDVAECGPGGS
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagaagcacaagaagcacaagtcggacaaacacctctacgaggagtatgtagag
aagcccttgaagctggtcctcaaagtaggagggaacgaagtcaccgaactctccacgggc
agctcggggcacgactccagcctcttcgaagacaaaaacgatcatgacaaacacaaggac
agaaagcggaaaaagagaaagaaaggagagaagcagattccaggggaagaaaaggggaga
aaacggagaagagttaaggaggataaaaagaagcgagatcgagaccgggtggagaatgag
gcagaaaaagatctccagtgtcacgcccctgtgagattagacttgcctcctgagaagcct
ctcacaagctctttagccaaacaagaagaagtagaacagacaccccttcaagaagctttg
aatcaactgatgagacaattgcagagaaaagatccaagtgctttcttttcatttcctgtg
actgattttattgctcctggctactccatgatcattaaacacccaatggattttagtacc
atgaaagaaaagatcaagaacaatgactatcagtccatagaagaactaaaggataacttc
aaactaatgtgtactaatgccatgatttacaataaaccagagaccatttattataaagct
gcaaagaagctgttgcactcaggaatgaaaattcttagccaggaaagaattcagagcctg
aagcagagcatagacttcatggctgacttgcagaaaactcgaaagcagaaagatggaaca
gacacctcacagagtggggaggacggaggctgctggcagagagagagagaggactctgga
gatgccgaagcacacgccttcaagagtcccagcaaagaaaataaaaagaaagacaaagat
atgcttgaagataagtttaaaagcaataatttagagagagagcaggagcagcttgaccgc
atcgtgaaggaatctggaggaaagctgaccaggcggcttgtgaacagtcagtgcgaattt
gaaagaagaaaaccagatggaacaacgacgttgggacttctccatcctgtggatcccatt
gtaggagagccaggctactgccctgtgagactgggaatgacaactggaagacttcagtct
ggagtgaatactttgcaggggttcaaagaggataaaaggaacaaagtcactccagtgtta
tatttgaattatgggccctacagttcttatgcaccgcattatgactccacatttgcaaat
atcagcaaggatgattctgatttaatctattcaacctatggggaagactctgatcttcca
agtgatttcagcatccatgagtttttggccacgtgccaagattatccgtatgtcatggca
gatagtttactggatgttttaacaaaaggagggcattccaggaccctacaagagatggag
atgtcattgcctgaagatgaaggccatactaggacacttgacacagcaaaagaaatggag
attacagaagtagagccaccagggcgtttggactccagtactcaagacaggctcatagcg
ctgaaagcagtaacaaattttggcgttccagttgaagtttttgactctgaagaagctgaa
atattccagaagaaacttgatgagaccaccagattgctcagggaactccaggaagcccag
aatgaacgtttgagcaccagaccccctccgaacatgatctgtctcttgggtccctcatac
agagaaatgcatcttgctgaacaagtgaccaataatcttaaagaacttgcacagcaagta
actccaggtgatatcgtaagcacgtatggagttcgaaaagcaatggggatttccattcct
tcccccgtcatggaaaacaactttgtggatttgacagaagacactgaagaacctaaaaag
acggatgttgctgagtgtggacctggtggaagttga

DBGET integrated database retrieval system