KEGG   Homo sapiens (human): 29128Help
Entry
29128             CDS       T01001                                 

Gene name
UHRF1, ICBP90, Np95, RNF106, TDRD22, hNP95, hUHRF1, huNp95
Definition
(RefSeq) ubiquitin like with PHD and ring finger domains 1
  KO
K10638  E3 ubiquitin-protein ligase UHRF1 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    29128 (UHRF1)
   03036 Chromosome and associated proteins [BR:hsa03036]
    29128 (UHRF1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     29128 (UHRF1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    29128 (UHRF1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   Other histone modification proteins
    29128 (UHRF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TTD SAD_SRA ubiquitin PHD zf-C3HC4_2 PHD_2 zf-RING_10 Rad60-SLD Prok-RING_4 zf-C3HC4 zf-RING_UBOX zf-RING_2 DUF3592
Motif
Other DBs
NCBI-GeneID: 29128
NCBI-ProteinID: NP_001041666
OMIM: 607990
HGNC: 12556
Ensembl: ENSG00000276043
Vega: OTTHUMG00000180251
Pharos: Q96T88(Tbio)
UniProt: Q96T88
Structure
PDB: 

Position
19p13.3
AA seq 793 aa AA seqDB search
MWIQVRTMDGRQTHTVDSLSRLTKVEELRRKIQELFHVEPGLQRLFYRGKQMEDGHTLFD
YEVRLNDTIQLLVRQSLVLPHSTKERDSELSDTDSGCCLGQSESDKSSTHGEAAAETDSR
PADEDMWDETELGLYKVNEYVDARDTNMGAWFEAQVVRVTRKAPSRDEPCSSTSRPALEE
DVIYHVKYDDYPENGVVQMNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYD
AEISRKRETRTARELYANVVLGDDSLNDCRIIFVDEVFKIERPGEGSPMVDNPMRRKSGP
SCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYC
PECRNDASEVVLAGERLRESKKKAKMASATSSSQRDWGKGMACVGRTKECTIVPSNHYGP
IPGIPVGTMWRFRVQVSESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDDVDHGNFFTYTG
SGGRDLSGNKRTAEQSCDQKLTNTNRALALNCFAPINDQEGAEAKDWRSGKPVRVVRNVK
GGKNSKYAPAEGNRYDGIYKVVKYWPEKGKSGFLVWRYLLRRDDDEPGPWTKEGKDRIKK
LGLTMQYPEGYLEALANREREKENSKREEEEQQEGGFASPRTGKGKWKRKSAGGGPSRAG
SPRRTSKKTKVEPYSLTAQQSSLIREDKSNAKLWNEVLASLKDRPASGSPFQLFLSKVEE
TFQCICCQELVFRPITTVCQHNVCKDCLDRSFRAQVFSCPACRYDLGRSYAMQVNQPLQT
VLNQLFPGYGNGR
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atgtggatccaggttcggaccatggacgggaggcagacccacacggtggactcgctgtcc
aggctgaccaaggtggaggagctgaggcggaagatccaggagctgttccacgtggagcca
ggcctgcagaggctgttctacaggggcaaacagatggaggacggccataccctcttcgac
tacgaggtccgcctgaatgacaccatccagctcctggtccgccagagcctcgtgctcccc
cacagcaccaaggagcgggactccgagctctccgacaccgactccggctgctgcctgggc
cagagtgagtcagacaagtcctccacccacggtgaggcggccgccgagactgacagcagg
ccagccgatgaggacatgtgggatgagacggaattggggctgtacaaggtcaatgagtac
gtcgatgctcgggacacgaacatgggggcgtggtttgaggcgcaggtggtcagggtgacg
cggaaggccccctcccgggacgagccctgcagctccacgtccaggccggcgctggaggag
gacgtcatttaccacgtgaaatacgacgactacccggagaacggcgtggtccagatgaac
tccagggacgtccgagcgcgcgcccgcaccatcatcaagtggcaggacctggaggtgggc
caggtggtcatgctcaactacaaccccgacaaccccaaggagcggggcttctggtacgac
gcggagatctccaggaagcgcgagaccaggacggcgcgggaactctacgccaacgtggtg
ctgggggatgattctctgaacgactgtcggatcatcttcgtggacgaagtcttcaagatt
gagcggccgggtgaagggagccccatggttgacaaccccatgagacggaagagcgggccg
tcctgcaagcactgcaaggacgacgtgaacagactctgccgggtctgcgcctgccacctg
tgcgggggccggcaggaccccgacaagcagctcatgtgcgatgagtgcgacatggccttc
cacatctactgcctggacccgcccctcagcagtgttcccagcgaggacgagtggtactgc
cctgagtgccggaatgatgccagcgaggtggtactggcgggagagcggctgagagagagc
aagaagaaggcgaagatggcctcggccacatcgtcctcacagcgggactggggcaagggc
atggcctgtgtgggccgcaccaaggaatgtaccatcgtcccgtccaaccactacggaccc
atcccggggatccccgtgggcaccatgtggcggttccgagtccaggtcagcgagtcgggt
gtccatcggccccacgtggctggcatacacggccggagcaacgacggagcgtactcccta
gtcctggcggggggctatgaggatgatgtggaccatgggaattttttcacatacacgggt
agtggtggtcgagatctttccggcaacaagaggaccgcggaacagtcttgtgatcagaaa
ctcaccaacaccaacagggcgctggctctcaactgctttgctcccatcaatgaccaagaa
ggggccgaggccaaggactggcggtcggggaagccggtcagggtggtgcgcaatgtcaag
ggtggcaagaatagcaagtacgcccccgctgagggcaaccgctacgatggcatctacaag
gttgtgaaatactggcccgagaaggggaagtccgggtttctcgtgtggcgctaccttctg
cggagggacgatgatgagcctggcccttggacgaaggaggggaaggaccggatcaagaag
ctggggctgaccatgcagtatccagaaggctacctggaagccctggccaaccgagagcga
gagaaggagaacagcaagagggaggaggaggagcagcaggaggggggcttcgcgtccccc
aggacgggcaagggcaagtggaagcggaagtcggcaggaggtggcccgagcagggccggg
tccccgcgccggacatccaagaaaaccaaggtggagccctacagtctcacggcccagcag
agcagcctcatcagagaggacaagagcaacgccaagctgtggaatgaggtcctggcgtca
ctcaaggaccggccggcgagcggcagcccgttccagttgttcctgagtaaagtggaggag
acgttccagtgtatctgctgtcaggagctggtgttccggcccatcacgaccgtgtgccag
cacaacgtgtgcaaggactgcctggacagatcctttcgggcacaggtgttcagctgccct
gcctgccgctacgacctgggccgcagctatgccatgcaggtgaaccagcctctgcagacc
gtcctcaaccagctcttccccggctacggcaatggccggtga

DBGET integrated database retrieval system